CX671278

Overview
NameCX671278
Unique NameCX671278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:67..782. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 8.453e-107
Identity = 186/218 (85.32%), Postives = 197/218 (90.37%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAV L+P  +E+   GR++MRKT   +  SGSPWYG DRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVKLSPGASEVFGTGRVTMRKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFV 230          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 8.453e-107
Identity = 186/201 (92.54%), Postives = 191/201 (95.02%), Query Frame = 2
Query:  119 GRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GRI+MRKT  K    +SGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   26 GRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV 226          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_APIGR (Chlorophyll a-b binding protein, chloroplastic OS=Apium graveolens GN=LHC0 PE=1 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.442e-106
Identity = 185/215 (86.05%), Postives = 196/215 (91.16%), Query Frame = 2
Query:   71 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GKAV +APS +EL   GR+SMRKT    VS  SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSIL+IWA QV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPE  AELK KE+KNGRLAMFSMFGFFV
Sbjct:   15 GKAVKVAPSSSELFGNGRVSMRKTVKAPVSD-SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILSIWATQVILMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLAEDPERSAELKVKELKNGRLAMFSMFGFFV 228          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.459e-106
Identity = 187/219 (85.39%), Postives = 199/219 (90.87%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAV   PS + L    R++MRKT +K+  VSS SPWYG DRV YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFS+GGLDYLGNPSL+HAQS+LAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+ P+AFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVKNLPS-SALIGDARVNMRKTAAKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNPSLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLAERPQAFAELKVKEIKNGRLAMFSMFGFFV 230          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 5.479e-106
Identity = 187/225 (83.11%), Postives = 199/225 (88.44%), Query Frame = 2
Query:   71 GKAVNLAPSGNELSNGG-------RISMRKTGSKSVS---SGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            G+  +L P  N+L   G       R++MRK  +K ++   S SPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPE FAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   14 GQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKLTASASTSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 238          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_HORVU (Chlorophyll a-b binding protein 2, chloroplastic OS=Hordeum vulgare GN=CAB2 PE=3 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 5.479e-106
Identity = 186/217 (85.71%), Postives = 193/217 (88.94%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAV    S +E+    R+SMRKT +     GSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFSEGGL YLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADD EAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVKNLSSSSEVQGDARVSMRKTAATK-KVGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEGGLQYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDAEAFAELKVKEIKNGRLAMFSMFGFFV 228          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.346e-106
Identity = 187/217 (86.18%), Postives = 195/217 (89.86%), Query Frame = 2
Query:   71 GKAVNLAPSGNELSNGGRISMRK--TGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GK + L PS  EL    R +MRK  T  K  SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   18 GKQLKLNPSSQELG-AARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV 233          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 380.948 bits (977), Expect = 3.551e-105
Identity = 189/213 (88.73%), Postives = 195/213 (91.55%), Query Frame = 2
Query:   89 APS-GNELSNGGRISMRKTGSK---SVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            APS  + L    RI+MRKT +K   + SSGSPWYG DRV YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEV DPLYPGG+FDPLGLADDPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   17 APSTSSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.638e-105
Identity = 188/219 (85.84%), Postives = 196/219 (89.50%), Query Frame = 2
Query:   71 GKAVNLA--PSGNELSNGGRISMRK--TGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GK V  +  PS  EL  G R +MRK  T  K  SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   15 GKPVETSANPSSQELG-GARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV 232          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_ORYSJ (Chlorophyll a-b binding protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB2R PE=2 SV=2)

HSP 1 Score: 380.178 bits (975), Expect = 6.058e-105
Identity = 185/201 (92.04%), Postives = 190/201 (94.53%), Query Frame = 2
Query:  119 GRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GRI+MRK+ +K    +SGSPWYG DRV YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   25 GRITMRKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV 225          
The following BLAST results are available for this feature:
BLAST of CX671278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB21_SINAL8.453e-10785.32Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB21_MAIZE8.453e-10792.54Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB23_APIGR1.442e-10686.05Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_WHEAT2.459e-10685.39Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2B_PINSY5.479e-10683.11Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB22_HORVU5.479e-10685.71Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB22_PEA9.346e-10686.18Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB21_ORYSJ3.551e-10588.73Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB28_PEA4.638e-10585.84Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB22_ORYSJ6.058e-10592.04Chlorophyll a-b binding protein 2, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A12_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A12-A24-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671278 ID=CX671278|Name=CX671278|organism=Citrus sinensis|type=EST|length=716bp
CACAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCGACCATGG
CTCTCTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTGCCCCTTCAGGC
AATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAGCAA
GTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGTACT
TGGGCCCACTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTCCCT
GGTGACTACGGTTGGGACACTGCTGGGCTTTCAGCTGACCCAGAAACCTT
TGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGTTGG
GAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTCAAG
TTCGGTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAGATCTTCAGCGAGGG
CGGGCTTGACTACTTGGGGAACCCAAGCCTGATCCACGCTCAGAGCATCT
TGGCCATCTGGGCTTGCCAGGTGGTCTTGATGGGAGCCGTTGAGGGTTAC
AGAATTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCCAGG
TGGCAGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTGCTG
AGCTCAAGGGTAAGGAAATCAAGAATGGAAGGTTGGCTATGTTCTCCATG
TTTGGTTTCTTCGTTC
back to top