CX671278

Overview
NameCX671278
Unique NameCX671278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:67..782. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.350e-104
Identity = 184/219 (84.02%), Postives = 198/219 (90.41%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVS-SGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAVNL+P+ +E+   GR++MRKT +K    SGSPWYG DRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.302e-104
Identity = 184/220 (83.64%), Postives = 198/220 (90.00%), Query Frame = 2
Query:   83 NLAPSGNELSNGG------RISMRK-TGSKSVSSG--SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            ++ P  N+L   G      R++MRK TG KSV++   SPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG+FDPLGLADDP+AFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   23 SVKPQNNQLLGVGGAHGEARLTMRKATGKKSVAASIDSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFV 242          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_ARATH (Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana GN=CAB2A PE=1 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 6.698e-104
Identity = 183/219 (83.56%), Postives = 197/219 (89.95%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVS-SGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAV L+P+ +E+   GR++MRKT +K    SGSPWYG DRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVKLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.142e-103
Identity = 182/220 (82.73%), Postives = 198/220 (90.00%), Query Frame = 2
Query:   83 NLAPSGNELSNGG------RISMRK-TGSKSVSSG--SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            ++ P  N+L   G      R++MRK TG KSV++   SPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG+FDPLGLADDP+AFA++K KEIKNGRLAMFSMFGFFV
Sbjct:   23 SVKPQNNQLLGVGGAHGEARLTMRKATGRKSVAASIDSPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVKEIKNGRLAMFSMFGFFV 242          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_SOYBN (Chlorophyll a-b binding protein 2, chloroplastic OS=Glycine max GN=CAB2 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 6.931e-101
Identity = 184/215 (85.58%), Postives = 192/215 (89.30%), Query Frame = 2
Query:   71 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            G+A+ LAPS  EL  G R+SMRKT  K+VSSGSPWYGPDRVKYLGP SGE PSYLTGEF G        LSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEA AELK KE+KNGRLAMFSMFGFFV
Sbjct:   15 GQAMKLAPSTPELGVG-RVSMRKTAPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFHG--------LSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEALAELKVKELKNGRLAMFSMFGFFV 220          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_PEA (Chlorophyll a-b binding protein AB96 (Fragment) OS=Pisum sativum GN=AB96 PE=1 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 3.803e-99
Identity = 172/192 (89.58%), Postives = 179/192 (93.23%), Query Frame = 2
Query:  140 TGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            T  K  SS SPW+GPD VKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+ PEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:    1 TTKKVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSMFGFFV 192          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 359.762 bits (922), Expect = 8.472e-99
Identity = 170/200 (85.00%), Postives = 184/200 (92.00%), Query Frame = 2
Query:  116 GGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GGR+SMR+T   + +S   WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWACQVVLMG VEGYR+ GGPLGE  DP+YPGG+FDPLGLADDP+AFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   32 GGRVSMRRTVKSAPTS--IWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2_PHYPA (Chlorophyll a-b binding protein, chloroplastic OS=Physcomitrella patens PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.107e-98
Identity = 169/198 (85.35%), Postives = 183/198 (92.42%), Query Frame = 2
Query:  122 RISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            R++MR+T SKS  S + WYG DR K+LGP SGE PSYL GEF GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGC+ PELLA++GVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEVTDP+YPGGSFDPLGLADDP+ FAELK KEIKNGRLAMFSMFGFFV
Sbjct:   35 RVTMRRTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFV 232          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_POLMU (Chlorophyll a-b binding protein type 1 member F3, chloroplastic OS=Polystichum munitum GN=CABF3 PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.492e-98
Identity = 174/210 (82.86%), Postives = 185/210 (88.10%), Query Frame = 2
Query:  101 NELSNG-----GRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            NELS        R+ M    SK+  SGS WYG DR  YLGP SG PPSYL+GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAG+QIF+EGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DP+YPGGSFDPLGLADDPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   21 NELSRKVGAGEARVQMMAPKSKA-PSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVEDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB48_MAIZE (Chlorophyll a-b binding protein 48, chloroplastic OS=Zea mays GN=CAB48 PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.560e-97
Identity = 171/201 (85.07%), Postives = 178/201 (88.56%), Query Frame = 2
Query:  119 GRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GRI+MRKT +K     SGSPWYG DRV YLGPLSG PPSYLTGEFPGDYGWDT GLSADPETFAKNRELEVIHCRWA+   LGCVFPELLARNGVKFGE VWFKAG+QIFSEGGL + GNPSL+HAQSILAIWACQVVLMGAVEGY +AGG LGEV DPLY GGSFDPLGL DDPE FAELK KEIKNGRLAMFSMFGFFV
Sbjct:   28 GRITMRKTAAKPKPARSGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEGLSADPETFAKNRELEVIHCRWAIAVGLGCVFPELLARNGVKFGEGVWFKAGSQIFSEGGLSHPGNPSLVHAQSILAIWACQVVLMGAVEGYHVAGGRLGEVVDPLYLGGSFDPLGLGDDPERFAELKVKEIKNGRLAMFSMFGFFV 228          
The following BLAST results are available for this feature:
BLAST of CX671278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB21_ARATH1.350e-10484.02Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB2A_PINSY2.302e-10483.64Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB22_ARATH6.698e-10483.56Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB2A_PYRPY1.142e-10382.73Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB22_SOYBN6.931e-10185.58Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_PEA3.803e-9989.58Chlorophyll a-b binding protein AB96 (Fragment) OS... [more]
CB21_GOSHI8.472e-9985.00Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB2_PHYPA1.107e-9885.35Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_POLMU5.492e-9882.86Chlorophyll a-b binding protein type 1 member F3, ... [more]
CB48_MAIZE3.560e-9785.07Chlorophyll a-b binding protein 48, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A12_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A12-A24-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671278 ID=CX671278|Name=CX671278|organism=Citrus sinensis|type=EST|length=716bp
CACAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCGACCATGG
CTCTCTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTGCCCCTTCAGGC
AATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAGCAA
GTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGTACT
TGGGCCCACTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTCCCT
GGTGACTACGGTTGGGACACTGCTGGGCTTTCAGCTGACCCAGAAACCTT
TGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGTTGG
GAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTCAAG
TTCGGTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAGATCTTCAGCGAGGG
CGGGCTTGACTACTTGGGGAACCCAAGCCTGATCCACGCTCAGAGCATCT
TGGCCATCTGGGCTTGCCAGGTGGTCTTGATGGGAGCCGTTGAGGGTTAC
AGAATTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCCAGG
TGGCAGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTGCTG
AGCTCAAGGGTAAGGAAATCAAGAATGGAAGGTTGGCTATGTTCTCCATG
TTTGGTTTCTTCGTTC
back to top