CX671278

Overview
NameCX671278
Unique NameCX671278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:67..782. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2F_SOLLC (Chlorophyll a-b binding protein 3B, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3B PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.890e-38
Identity = 76/80 (95.00%), Postives = 78/80 (97.50%), Query Frame = 2
Query:  476 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:  152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2E_SOLLC (Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3A PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.890e-38
Identity = 76/80 (95.00%), Postives = 78/80 (97.50%), Query Frame = 2
Query:  476 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:  152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.890e-38
Identity = 76/80 (95.00%), Postives = 78/80 (97.50%), Query Frame = 2
Query:  476 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:    1 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 80          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2C_SOLLC (Chlorophyll a-b binding protein 1C, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1C PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.890e-38
Identity = 76/80 (95.00%), Postives = 78/80 (97.50%), Query Frame = 2
Query:  476 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:  150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2A_SOLLC (Chlorophyll a-b binding protein 1A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1A PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.890e-38
Identity = 76/80 (95.00%), Postives = 78/80 (97.50%), Query Frame = 2
Query:  476 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:  150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_RAPSA (Chlorophyll a-b binding of LHCII type 1 protein (Fragment) OS=Raphanus sativus PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 7.807e-36
Identity = 75/88 (85.23%), Postives = 78/88 (88.64%), Query Frame = 2
Query:  455 LDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            LDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPL    DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:    1 LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGPLGEAEDLLYPGGSFDPLASLTDPEAFAELKVKEIKNGRLAMFSMFGFFV 88          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.565e-26
Identity = 81/218 (37.16%), Postives = 106/218 (48.62%), Query Frame = 2
Query:   68 VGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEP-PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGA-QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            VG    LAPS     +G       T S  V+  + W+            G+P P++L G  PGD+G+D  GL+  PE F + +E E+ HCRWAML   G + PE L       G   W KA       +G   YLGNP  +   ++  I A + + +   E  R       +     YPGG+FDPLG + DP  F ELK KEIKNGRLAM +  GF V
Sbjct:   13 VGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEWF-----------PGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEAL-------GLGNWVKAQEWAALPDGQATYLGNP--VPWGNLPTILAIEFLAIAFAEQQRTME---KDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCV 207          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.058e-24
Identity = 71/171 (41.52%), Postives = 92/171 (53.80%), Query Frame = 2
Query:  209 LSGEP-PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGG-LDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            + G+P PSYL G  PGD+G+D+ GL   P    + +E E+IHCRWAML   G + PE L       G   W KA       GG   YLG P  +   ++  I A + + +  VE  R       +     YPGG+FDPLG + DP  F ELK KEIKNGRLA+ ++ GF V
Sbjct:   50 MPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEAL-------GLGNWVKAQEWAAIPGGQATYLGQP--VPWGTLPTILAIEFLAIAFVEHQR---SMEKDSEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCV 208          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.356e-24
Identity = 67/169 (39.64%), Postives = 91/169 (53.85%), Query Frame = 2
Query:  221 PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA-----CQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS-FDPLGL-ADDPEAFAELKGKEIKNGRLAMFSMFG 706
            PP +L G  PGD+G+D  GL++DPE+   N++ E++HCRWAMLGA G   PELL + G+      W+ AG Q +      +    +L   + +L  WA       ++  G V    I        TD  YPGG  FDPLG  +  P    EL+ KEIKNGRLAM ++ G
Sbjct:   74 PPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGI-LNTPSWYTAGEQEY------FTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMG 235          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.855e-24
Identity = 73/195 (37.44%), Postives = 98/195 (50.26%), Query Frame = 2
Query:  143 GSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA-----CQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS-FDPLGL-ADDPEAFAELKGKEIKNGRLAMFSMFG 706
            GS+SV+  +    PDR  +       PP +L G  PGD+G+D  GL +DPE+   N + E++H RWAMLGA G   PE L + GV      W+ AG Q +      +    +L   + +L  WA       ++  G V    I        TD  YPGG  FDPLG  +  P    EL+ KEIKNGRLAM ++ G
Sbjct:   50 GSRSVAVSAVAADPDRPLWFP--GSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGV-LNTPSWYTAGEQEY------FTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMG 235          
The following BLAST results are available for this feature:
BLAST of CX671278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB2F_SOLLC4.890e-3895.00Chlorophyll a-b binding protein 3B, chloroplastic ... [more]
CB2E_SOLLC4.890e-3895.00Chlorophyll a-b binding protein 3A, chloroplastic ... [more]
CB2D_SOLLC4.890e-3895.00Chlorophyll a-b binding protein 1D (Fragment) OS=S... [more]
CB2C_SOLLC4.890e-3895.00Chlorophyll a-b binding protein 1C, chloroplastic ... [more]
CB2A_SOLLC4.890e-3895.00Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB21_RAPSA7.807e-3685.23Chlorophyll a-b binding of LHCII type 1 protein (F... [more]
CB121_HORVU9.565e-2637.16Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC1.058e-2441.52Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB12_SOLLC2.356e-2439.64Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB12_PETHY6.855e-2437.44Chlorophyll a-b binding protein, chloroplastic OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A12_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A12-A24-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671278 ID=CX671278|Name=CX671278|organism=Citrus sinensis|type=EST|length=716bp
CACAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCGACCATGG
CTCTCTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTGCCCCTTCAGGC
AATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAGCAA
GTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGTACT
TGGGCCCACTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTCCCT
GGTGACTACGGTTGGGACACTGCTGGGCTTTCAGCTGACCCAGAAACCTT
TGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGTTGG
GAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTCAAG
TTCGGTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAGATCTTCAGCGAGGG
CGGGCTTGACTACTTGGGGAACCCAAGCCTGATCCACGCTCAGAGCATCT
TGGCCATCTGGGCTTGCCAGGTGGTCTTGATGGGAGCCGTTGAGGGTTAC
AGAATTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCCAGG
TGGCAGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTGCTG
AGCTCAAGGGTAAGGAAATCAAGAATGGAAGGTTGGCTATGTTCTCCATG
TTTGGTTTCTTCGTTC
back to top