CV713072
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CV713072 vs. ExPASy Swiss-Prot
Match: THIO_OPHHA (Thioredoxin OS=Ophiophagus hannah GN=TXN PE=3 SV=3) HSP 1 Score: 70.0922 bits (170), Expect = 4.583e-12 Identity = 30/73 (41.10%), Postives = 49/73 (67.12%), Query Frame = 3 Query: 3 GPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHL 221 GPC+ I PF + +K P+V+F+++DVD+ + VA+ V+ MPTF F K + V + GA KE+L++ I K++ Sbjct: 33 GPCKMIKPFFHSMVEKYPDVVFIEIDVDDAQDVASHCDVKCMPTFQFYKNNEKVHEFSGANKEKLEEAIKKYM 105
BLAST of CV713072 vs. ExPASy Swiss-Prot
Match: THIO_PONAB (Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3) HSP 1 Score: 69.3218 bits (168), Expect = 7.817e-12 Identity = 34/70 (48.57%), Postives = 49/70 (70.00%), Query Frame = 3 Query: 3 GPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTF-MFLKEGKIVDKVVGAKKEELQQTI 209 GPC+ I PF L++K NV+FL+VDVD+ + VA++ V+ MPTF F K+G+ V + GA KE+L+ TI Sbjct: 33 GPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFFKKGQKVGEFSGANKEKLEATI 102
BLAST of CV713072 vs. ExPASy Swiss-Prot
Match: TRXL4_ARATH (Thioredoxin-like 4 OS=Arabidopsis thaliana GN=At1g11530 PE=2 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 2.274e-11 Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = 3 Query: 6 PCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTI 209 P F+ F ELA + LFL VDVDE+K VA+ V+AMPTF+FLK+G +DK+VGA +E+++ + Sbjct: 38 PSVFMNSFFEELAFNYKDALFLIVDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRV 105
BLAST of CV713072 vs. ExPASy Swiss-Prot
Match: THIO1_CAEEL (Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.879e-11 Identity = 29/74 (39.19%), Postives = 48/74 (64.86%), Query Frame = 3 Query: 3 GPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLA 224 GPC+ IAP ELA ++F KVDVDE + + + + V+ MPTF+F K G ++ + G ++EL+Q + +H++ Sbjct: 40 GPCKAIAPLYKELATTHKGIIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDELRQKVLEHVS 113
BLAST of CV713072 vs. ExPASy Swiss-Prot
Match: TRX1_YEAST (Thioredoxin-1 OS=Saccharomyces cerevisiae GN=TRX1 PE=1 SV=3) HSP 1 Score: 65.855 bits (159), Expect = 8.643e-11 Identity = 33/70 (47.14%), Postives = 43/70 (61.43%), Query Frame = 3 Query: 3 GPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIA 212 GPC+ IAP + + +++ P F K+DVDEL VA V AMPT + K GK V KVVGA ++Q IA Sbjct: 31 GPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIA 100
BLAST of CV713072 vs. ExPASy Swiss-Prot
Match: THIO_GEOCY (Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 8.643e-11 Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = 3 Query: 3 GPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGK-IVDKVVGAKKEELQQTIAKH 218 GPC+ IAP E+AK+ P+V+F KVDVDE A ++AMPTF F K GK + D V GA + L++ I K+ Sbjct: 33 GPCQRIAPKYVEMAKEFPDVIFYKVDVDENDETAEAEKIQAMPTFKFYKSGKALSDYVQGANEAGLREKIKKN 105 The following BLAST results are available for this feature:
BLAST of CV713072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 36
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CV713072 ID=CV713072; Name=CV713072; organism=Citrus sinensis; type=EST; length=444bpback to top |