GO241389

Overview
NameGO241389
Unique NameGO241389
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5655 contig Csv1_Contig5655:306..917. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HAT2_ARATH (Homeobox-leucine zipper protein HAT2 OS=Arabidopsis thaliana GN=HAT2 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.370e-15
Identity = 45/110 (40.91%), Postives = 65/110 (59.09%), Query Frame = 2
Query:    8 DFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVT 337
            D  +DG +   KK RL+ +Q   LE+ F+  N L P++K+ LA+ L L  RQV +WFQNRRAR K KQ E D + LKR         E L  +N++L  E M L++ +++
Sbjct:  119 DEEEDGGETSRKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCV-------EKLTEENRRLQKEAMELRTLKLS 221          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HAT1_ARATH (Homeobox-leucine zipper protein HAT1 OS=Arabidopsis thaliana GN=HAT1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.370e-15
Identity = 47/106 (44.34%), Postives = 62/106 (58.49%), Query Frame = 2
Query:    5 DDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALK 322
            D+  D G +   KK RL+ +Q   LE  F+  N L P++K+ LA+ LGL  RQV +WFQNRRAR K KQ E D + LKR  E +  +   L    +K  AE+ ALK
Sbjct:  123 DEEEDYGGETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRL----EKEAAELRALK 224          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX14_ORYSJ (Homeobox-leucine zipper protein HOX14 OS=Oryza sativa subsp. japonica GN=HOX14 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.454e-15
Identity = 49/113 (43.36%), Postives = 66/113 (58.41%), Query Frame = 2
Query:   41 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVT--ESINLNKETEGS 373
            KKRRL+ EQV+ LE +F    KLE  RK+ LA  LGL P+QVA+WFQNRRAR K+K LE+++  LK  ++A    +         L  E++ LK R V   E +   +   GS
Sbjct:   62 KKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHKSKLLEEEFSKLKHAHDAAILHK-------CHLENEVLRLKERLVVAEEEVRRLRSAAGS 167          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX14_ORYSI (Homeobox-leucine zipper protein HOX14 OS=Oryza sativa subsp. indica GN=HOX14 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.454e-15
Identity = 49/113 (43.36%), Postives = 66/113 (58.41%), Query Frame = 2
Query:   41 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVT--ESINLNKETEGS 373
            KKRRL+ EQV+ LE +F    KLE  RK+ LA  LGL P+QVA+WFQNRRAR K+K LE+++  LK  ++A    +         L  E++ LK R V   E +   +   GS
Sbjct:   62 KKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHKSKLLEEEFSKLKHAHDAAILHK-------CHLENEVLRLKERLVVAEEEVRRLRSAAGS 167          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX17_ORYSJ (Homeobox-leucine zipper protein HOX17 OS=Oryza sativa subsp. japonica GN=HOX17 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.271e-14
Identity = 43/94 (45.74%), Postives = 55/94 (58.51%), Query Frame = 2
Query:   23 GSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHA 304
            G     KK RL+ +Q   LE +F     L P +K  LA+ LGL+PRQV +WFQNRRAR K KQ E D + LKR  E +  +   LQ + Q+L A
Sbjct:   76 GIDGSRKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELRA 169          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX17_ORYSI (Homeobox-leucine zipper protein HOX17 OS=Oryza sativa subsp. indica GN=HOX17 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.271e-14
Identity = 43/94 (45.74%), Postives = 55/94 (58.51%), Query Frame = 2
Query:   23 GSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHA 304
            G     KK RL+ +Q   LE +F     L P +K  LA+ LGL+PRQV +WFQNRRAR K KQ E D + LKR  E +  +   LQ + Q+L A
Sbjct:   76 GIDGSRKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELRA 169          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX7_ORYSJ (Homeobox-leucine zipper protein HOX7 OS=Oryza sativa subsp. japonica GN=HOX7 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.169e-14
Identity = 44/106 (41.51%), Postives = 59/106 (55.66%), Query Frame = 2
Query:    8 DFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKS 325
            D  D+G     KK RL+ EQ   LE +F+  + L P++K  LA  L L+PRQV +WFQNRRAR K KQ E D + LKR  E +  +   LQ +  +L   +    S
Sbjct:  142 DDEDNGGGGARKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRCCERLTRENRRLQREVAELRGTLRTTTS 247          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX7_ORYSI (Homeobox-leucine zipper protein HOX7 OS=Oryza sativa subsp. indica GN=HOX7 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.169e-14
Identity = 44/106 (41.51%), Postives = 59/106 (55.66%), Query Frame = 2
Query:    8 DFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKS 325
            D  D+G     KK RL+ EQ   LE +F+  + L P++K  LA  L L+PRQV +WFQNRRAR K KQ E D + LKR  E +  +   LQ +  +L   +    S
Sbjct:  142 DDEDNGGGGARKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRCCERLTRENRRLQREVAELRGALRTTTS 247          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HAT9_ARATH (Homeobox-leucine zipper protein HAT9 OS=Arabidopsis thaliana GN=HAT9 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.169e-14
Identity = 46/112 (41.07%), Postives = 65/112 (58.04%), Query Frame = 2
Query:    5 DDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTE 340
            D   D+   +  KK RL  +Q   LE++F+  + L P++K  LAR L L+PRQV +WFQNRRAR K KQ E D + LK+         E L  +N +L  EI  LK+ ++T+
Sbjct:  101 DYHEDEEGISARKKLRLTKQQSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCC-------ETLADENIRLQKEIQELKTLKLTQ 205          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HAT14_ARATH (Homeobox-leucine zipper protein HAT14 OS=Arabidopsis thaliana GN=HAT14 PE=2 SV=3)

HSP 1 Score: 78.5666 bits (192), Expect = 2.832e-14
Identity = 41/95 (43.16%), Postives = 62/95 (65.26%), Query Frame = 2
Query:   14 SDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKL 298
            +DD + +  KK RL+ +Q   LE +F+  + L P++K+ LA+ L L+PRQV +WFQNRRAR K KQ E D + LKR  E++  +   LQ + ++L
Sbjct:  181 NDDENGSTRKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKEL 275          
The following BLAST results are available for this feature:
BLAST of GO241389 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
HAT2_ARATH4.370e-1540.91Homeobox-leucine zipper protein HAT2 OS=Arabidopsi... [more]
HAT1_ARATH4.370e-1544.34Homeobox-leucine zipper protein HAT1 OS=Arabidopsi... [more]
HOX14_ORYSJ7.454e-1543.36Homeobox-leucine zipper protein HOX14 OS=Oryza sat... [more]
HOX14_ORYSI7.454e-1543.36Homeobox-leucine zipper protein HOX14 OS=Oryza sat... [more]
HOX17_ORYSJ1.271e-1445.74Homeobox-leucine zipper protein HOX17 OS=Oryza sat... [more]
HOX17_ORYSI1.271e-1445.74Homeobox-leucine zipper protein HOX17 OS=Oryza sat... [more]
HOX7_ORYSJ2.169e-1441.51Homeobox-leucine zipper protein HOX7 OS=Oryza sati... [more]
HOX7_ORYSI2.169e-1441.51Homeobox-leucine zipper protein HOX7 OS=Oryza sati... [more]
HAT9_ARATH2.169e-1441.07Homeobox-leucine zipper protein HAT9 OS=Arabidopsi... [more]
HAT14_ARATH2.832e-1443.16Homeobox-leucine zipper protein HAT14 OS=Arabidops... [more]

Pages

back to top
Libraries
Library NameType
Cara cara navel orange fruit cDNA librarycdna_library
Properties
Property NameValue
Genbank description37 Cara cara navel orange fruit cDNA library Citrus sinensis cDNA clone 119 5, mRNA sequence.