CN189611
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN189611 vs. ExPASy Swiss-Prot
Match: S26A2_BUBBU (Sulfate transporter OS=Bubalus bubalis GN=SLC26A2 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.167e-11 Identity = 30/87 (34.48%), Postives = 55/87 (63.22%), Query Frame = 1 Query: 355 PIFEWAPRYSFQF-LKADLIAGITIASLAIPQGISYAKLANLPPILGLYSSFVPPLVYAIMGSSKDLAVGTVAVASLLIASFLGQEV 612 P+ +W P+Y + + D+++G+ + L +PQ I+Y+ LA PI GLY+SF L+Y I+G+S+ ++VG + L+I + +E+ Sbjct: 95 PVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFILGTSRHISVGIFGILCLMIGEVVDREL 181
BLAST of CN189611 vs. ExPASy Swiss-Prot
Match: S26A2_BOVIN (Sulfate transporter OS=Bos taurus GN=SLC26A2 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.167e-11 Identity = 30/87 (34.48%), Postives = 55/87 (63.22%), Query Frame = 1 Query: 355 PIFEWAPRYSFQF-LKADLIAGITIASLAIPQGISYAKLANLPPILGLYSSFVPPLVYAIMGSSKDLAVGTVAVASLLIASFLGQEV 612 P+ +W P+Y + + D+++G+ + L +PQ I+Y+ LA PI GLY+SF L+Y I+G+S+ ++VG + L+I + +E+ Sbjct: 95 PVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFILGTSRHISVGIFGILCLMIGEVVDREL 181
BLAST of CN189611 vs. ExPASy Swiss-Prot
Match: S26A2_MOUSE (Sulfate transporter OS=Mus musculus GN=Slc26a2 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.830e-11 Identity = 29/89 (32.58%), Postives = 55/89 (61.80%), Query Frame = 1 Query: 352 FPIFEWAPRYSFQF-LKADLIAGITIASLAIPQGISYAKLANLPPILGLYSSFVPPLVYAIMGSSKDLAVGTVAVASLLIASFLGQEVN 615 FP+ W P+Y + + D+++G+ + L +PQ I+Y+ LA PI GLY+SF ++Y + G+S+ ++VG + L+I + +E++ Sbjct: 93 FPVLRWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVGIFGILCLMIGEVVDRELH 181 The following BLAST results are available for this feature:
BLAST of CN189611 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 53
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN189611 ID=CN189611; Name=CN189611; organism=Citrus sinensis; type=EST; length=692bpback to top |