CN189339
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN189339 vs. ExPASy Swiss-Prot
Match: SECA_BLOFL (Protein translocase subunit secA OS=Blochmannia floridanus GN=secA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.726e-11 Identity = 31/39 (79.49%), Postives = 34/39 (87.18%), Query Frame = -3 Query: 145 VKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRF 261 V + GGLHVIGT HESRRIDNQLRGR+GRQGD GS+RF Sbjct: 550 VLKSGGLHVIGTERHESRRIDNQLRGRSGRQGDAGSSRF 588
BLAST of CN189339 vs. ExPASy Swiss-Prot
Match: SECA_ALISL (Protein translocase subunit secA OS=Aliivibrio salmonicida (strain LFI1238) GN=secA PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.726e-11 Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = -3 Query: 145 GGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRF 249 GGLH+IGT HESRRIDNQLRGRAGRQGD GS+RF Sbjct: 552 GGLHIIGTERHESRRIDNQLRGRAGRQGDAGSSRF 586
BLAST of CN189339 vs. ExPASy Swiss-Prot
Match: SECA1_MYCVP (Protein translocase subunit secA 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=secA1 PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.726e-11 Identity = 30/43 (69.77%), Postives = 35/43 (81.40%), Query Frame = -3 Query: 145 EGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRF 273 E +V GGL+V+GT HESRRIDNQLRGR+GRQGDPG +RF Sbjct: 538 EAKDVIAAGGLYVLGTERHESRRIDNQLRGRSGRQGDPGESRF 580 The following BLAST results are available for this feature:
BLAST of CN189339 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 483
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN189339 ID=CN189339; Name=CN189339; organism=Citrus sinensis; type=EST; length=572bpback to top |