CN189256
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAAN (Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAAM (Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAAC (Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAAB (Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.092e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAES (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.651e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAEQ (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.651e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_STAHJ (Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.686e-12 Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = -2 Query: 241 VVDFTASW*GPCRFIAPFLAELAKKLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAK-KEELQQTIAKHL 486 +VDF A+W GPC+ IAP L ELA LK+DVDE S A + V ++PT + K+G+ VDKVVG + KE L + + KHL Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKFEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKHL 104
BLAST of CN189256 vs. ExPASy Swiss-Prot
Match: THIO_NEUCR (Thioredoxin OS=Neurospora crassa GN=trx PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.686e-12 Identity = 37/71 (52.11%), Postives = 46/71 (64.79%), Query Frame = -2 Query: 298 TKQLVVVDFTASW*GPCRFIAPFLAELAK--KLPNVL-FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIV 501 T Q VV DF A W GPC+ IAP A+ AK +PN L F K++VD ++ VA + V AMPTF+F K GK V Sbjct: 20 TTQYVVADFYADWCGPCKAIAPMYAQFAKTFSIPNFLAFAKINVDSVQQVAQHYRVSAMPTFLFFKNGKQV 90 The following BLAST results are available for this feature:
BLAST of CN189256 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN189256 ID=CN189256; Name=CN189256; organism=Citrus sinensis; type=EST; length=568bpback to top |