CX286910
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX286910 vs. ExPASy Swiss-Prot
Match: TCTP_SCHPO (Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe GN=p23fy PE=1 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.605e-11 Identity = 36/104 (34.62%), Postives = 58/104 (55.77%), Query Frame = -2 Query: 201 VVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 503 V ++V +FRL +FDKK +++Y+K ++K + +L E ER +F+KN G K +L+ D F++GESM D +V Y+E P ++ D L K Sbjct: 65 VNNLVYSFRLSPT-SFDKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKKILANFKDYDFYIGESMDPDAMVVLMNYREDGITPYMIFFKDGLVSEK 167
BLAST of CX286910 vs. ExPASy Swiss-Prot
Match: TCTP_LABRO (Translationally-controlled tumor protein homolog OS=Labeo rohita GN=tpt1 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.605e-11 Identity = 37/104 (35.58%), Postives = 56/104 (53.85%), Query Frame = -2 Query: 198 VDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 500 VDIV +LQE ++DKK + Y+K ++K + KL E +R + F N K +L + + QFF GESM+ DG + ++E P L+ D L+ KC Sbjct: 69 VDIVLNHKLQET-SYDKKSYTAYIKDYMKAVKAKLQEVAPDRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMLFFKDGLEIEKC 171 The following BLAST results are available for this feature:
BLAST of CX286910 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX286910 ID=CX286910; Name=CX286910; organism=Citrus clementina; type=EST; length=507bpback to top |