CX286996
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX286996 vs. ExPASy Swiss-Prot
Match: ACSF_PROMA (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase OS=Prochlorococcus marinus GN=acsF PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 4.748e-12 Identity = 40/96 (41.67%), Postives = 59/96 (61.46%), Query Frame = 3 Query: 342 IKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRR 629 + E LLTPRFYTT+F++ + EI +K +FEA+ +E + DYN HF R K E D++ + ++ +L RS +EFSGFLL+KE+ R Sbjct: 21 LDENLLTPRFYTTEFEKAAKT-DLEIARK----DFEAMFKEMEADYNLKHFDR-KASLERLDELSPEDKAVYESYLVRSVVSEFSGFLLFKEISNR 110
BLAST of CX286996 vs. ExPASy Swiss-Prot
Match: ACSF_PROM3 (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase OS=Prochlorococcus marinus (strain MIT 9303) GN=acsF PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 6.201e-12 Identity = 38/96 (39.58%), Postives = 59/96 (61.46%), Query Frame = 3 Query: 342 IKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRR 629 + + LLTPRFYTT+FD+ T+++ + + +FEA+ +E + DYN HF R + AD + + I+ +L RS +EFSGFLL+KE+ R Sbjct: 23 LDDNLLTPRFYTTEFDKAA---KTDLD--IARKDFEAMFKEMEADYNLKHFDRKASLERLAD-LSPEDKAIYESYLVRSVVSEFSGFLLFKEISNR 112
BLAST of CX286996 vs. ExPASy Swiss-Prot
Match: ACSF_PROMM (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase OS=Prochlorococcus marinus (strain MIT 9313) GN=acsF PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.356e-11 Identity = 38/96 (39.58%), Postives = 59/96 (61.46%), Query Frame = 3 Query: 342 IKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRR 629 + + LLTPRFYTT+FD+ T+++ + + +FEA+ +E + DYN HF R K E ++ + I+ +L RS +EFSGFLL+KE+ R Sbjct: 23 LDDNLLTPRFYTTEFDKAA---KTDLD--IARKDFEAMFKEMEADYNLKHFDR-KASLERLSELSPEDKAIYESYLVRSVVSEFSGFLLFKEISNR 112
BLAST of CX286996 vs. ExPASy Swiss-Prot
Match: ACSF_PROM4 (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase OS=Prochlorococcus marinus (strain MIT 9211) GN=acsF PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.856e-11 Identity = 34/96 (35.42%), Postives = 56/96 (58.33%), Query Frame = 3 Query: 342 IKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRR 629 + E LLTPRFYTT+FD+ + + ++ + +F+A+ E + DYN HF R +++ + ++ +L RS +EFSGFLL+KE+ R Sbjct: 23 LDENLLTPRFYTTEFDKA-----AKTDLEIARRDFQAMFNEMEADYNLKHFDRKASLARL-NELSPKDKSVYESYLVRSVVSEFSGFLLFKEISNR 112 The following BLAST results are available for this feature:
BLAST of CX286996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 44
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX286996 ID=CX286996; Name=CX286996; organism=Citrus clementina; type=EST; length=630bpback to top |