CX287061
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2) HSP 1 Score: 113.235 bits (282), Expect = 4.107e-25 Identity = 51/54 (94.44%), Postives = 52/54 (96.30%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS+Q PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGA Sbjct: 56 KYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGA 109
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB23_APIGR (Chlorophyll a-b binding protein, chloroplastic OS=Apium graveolens GN=LHC0 PE=1 SV=1) HSP 1 Score: 112.849 bits (281), Expect = 5.364e-25 Identity = 51/54 (94.44%), Postives = 52/54 (96.30%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 55 KYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 108
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB23_SOYBN (Chlorophyll a-b binding protein 3, chloroplastic OS=Glycine max GN=CAB3 PE=3 SV=1) HSP 1 Score: 112.464 bits (280), Expect = 7.006e-25 Identity = 51/54 (94.44%), Postives = 52/54 (96.30%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 54 KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 107
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 112.464 bits (280), Expect = 7.006e-25 Identity = 51/54 (94.44%), Postives = 52/54 (96.30%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 36 KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 89
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1) HSP 1 Score: 112.464 bits (280), Expect = 7.006e-25 Identity = 51/54 (94.44%), Postives = 52/54 (96.30%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 53 KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 106
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1) HSP 1 Score: 112.464 bits (280), Expect = 7.006e-25 Identity = 51/54 (94.44%), Postives = 52/54 (96.30%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA Sbjct: 46 KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 99
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1) HSP 1 Score: 112.079 bits (279), Expect = 9.150e-25 Identity = 50/54 (92.59%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGA Sbjct: 59 KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGA 112
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1) HSP 1 Score: 112.079 bits (279), Expect = 9.150e-25 Identity = 50/54 (92.59%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGA Sbjct: 60 KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGA 113
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB22_ARATH (Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana GN=CAB2A PE=1 SV=1) HSP 1 Score: 112.079 bits (279), Expect = 9.150e-25 Identity = 50/54 (92.59%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA Sbjct: 57 KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA 110
BLAST of CX287061 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1) HSP 1 Score: 112.079 bits (279), Expect = 9.150e-25 Identity = 50/54 (92.59%), Postives = 53/54 (98.15%), Query Frame = 2 Query: 2 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA 163 KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA Sbjct: 57 KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA 110 The following BLAST results are available for this feature:
BLAST of CX287061 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 58
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287061 ID=CX287061; Name=CX287061; organism=Citrus clementina; type=EST; length=165bpback to top |