CX287277

Overview
NameCX287277
Unique NameCX287277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length546
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9879 contig Ccv1_Contig9879:16..561. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS2_CHLRE (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Chlamydomonas reinhardtii GN=RBCS-2 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.004e-31
Identity = 76/174 (43.68%), Postives = 98/174 (56.32%), Query Frame = 1
Query:   43 SSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEF-ELEKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            SS + A A  A     S V P   LK     PA K       + A+       M VW P   K FET SYLPPLSDE +  ++ Y++ +GWIPCLEF E +K +V  E     G     YYD RYWTMWKLPM+GC D  QVL+E+    K +P ++VR++ FDN++QVQ + F
Sbjct:    8 SSVSAAVARPAR----SSVRPMAALK-----PAVKAAPVAAPAQANQ------MMVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIVANGWIPCLEFAESDKAYVSNESAIRFGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGF 166          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_CHLMO (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Chlamydomonas moewusii GN=RBCS PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.617e-31
Identity = 57/120 (47.50%), Postives = 81/120 (67.50%), Query Frame = 1
Query:  205 KVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFE------LEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            KVW P   K++ET SYLPPL+++ + +++ Y++ +GW PCLEF       +      R    S GYYD RYWTMWKLPM+GCTD +QVL+EV   Q  +P+ ++R++ FDN +QVQC+ F
Sbjct:   30 KVWQPVNNKQYETFSYLPPLTNQKIGRQVDYIINNGWTPCLEFADPSTSFVSNANAVRLQGVSAGYYDNRYWTMWKLPMFGCTDPSQVLREVSACQVAFPNVYIRLVAFDNVKQVQCMGF 149          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_CHLRE (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Chlamydomonas reinhardtii GN=RBCS-1 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.418e-31
Identity = 75/174 (43.10%), Postives = 98/174 (56.32%), Query Frame = 1
Query:   43 SSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEF-ELEKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            SS + A A  A     S V P   LK     PA K       + A+       M VW P   K FET SYLPPL+DE +  ++ Y++ +GWIPCLEF E +K +V  E     G     YYD RYWTMWKLPM+GC D  QVL+E+    K +P ++VR++ FDN++QVQ + F
Sbjct:    8 SSVSAAVARPAR----SSVRPMAALK-----PAVKAAPVAAPAQANQ------MMVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESAIRFGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGF 166          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_SINAL (Ribulose bisphosphate carboxylase small chain (Fragment) OS=Sinapis alba GN=RBCS PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.936e-30
Identity = 56/71 (78.87%), Postives = 65/71 (91.55%), Query Frame = 1
Query:  334 ELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            ELE G+VYREH S+PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP++F+RIIGFDN RQVQCISF
Sbjct:    1 ELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISF 71          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS3_ACECL (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia cliftonii GN=RBCS-3 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.199e-29
Identity = 65/146 (44.52%), Postives = 85/146 (58.22%), Query Frame = 1
Query:  133 FPATKKTNNDITSIASNGGRVQC--MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            FP   K N      ASN    +C  M VW P   K FET SYLPPL+DE + K++ Y+L + W PCLEF   ++ +   E+    G     Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   F
Sbjct:   22 FPRATKNNK---GFASNAAVQKCRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTPCLEFAASDQAYAGNENCIRMGPVSSTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGF 164          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS4_ACECL (Ribulose bisphosphate carboxylase small chain 4, chloroplastic OS=Acetabularia cliftonii GN=RBCS-4 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.708e-28
Identity = 64/151 (42.38%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  112 GLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            G    SA P          + A N  R   M VW P   K FET SYLPPL+DE + K++ Y+L + W PCLEF   ++ +   E+    G     Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   F
Sbjct:   15 GCTKPSAVPKVSINRKGFLNTAMNKKRE--MMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGF 163          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS5_ACECL (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Acetabularia cliftonii GN=RBCS-5 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.537e-28
Identity = 66/165 (40.00%), Postives = 91/165 (55.15%), Query Frame = 1
Query:   73 ASLAQASMVAPFTGLKSSSAFPATKKTNNDITS-IASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A++   ++V    G   SS+ P          S +A    R   M VW P   K FET SYLPPL+DE + K++ Y+L + W PCLEF   ++ +   E+    G     Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   F
Sbjct:    3 AAMMNKTIVVSKDGCARSSSIPKVATNKMGFASAVAMKKSRE--MMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGF 165          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_BATOE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Batophora oerstedii GN=RBCS PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 6.034e-28
Identity = 59/131 (45.04%), Postives = 82/131 (62.60%), Query Frame = 1
Query:  178 SNG--GRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFE-LEKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            SNG   + + M VW P   K FET SYLPPL+D+ + K++ Y+LR+ W PCLEF   ++ +V  ++    G     Y D RYWTMWKLPM+GC D +QVL E+    K +P +++R++ FD  RQVQ   F
Sbjct:   26 SNGTISKSRAMMVWEPFNNKFFETFSYLPPLTDDQITKQVDYILRNNWTPCLEFAGSDQAYVTHDNTVRMGDCASTYQDNRYWTMWKLPMFGCIDGSQVLTEISACTKAFPDAYIRLVCFDANRQVQISGF 156          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS6_ACECL (Ribulose bisphosphate carboxylase small chain 6, chloroplastic OS=Acetabularia cliftonii GN=RBCS-6 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.029e-27
Identity = 57/121 (47.11%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  202 MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            M VW P   K FET SYLPPL+DE + K++ Y+L + W PCLEF   ++ +   E+  + G     Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   F
Sbjct:   43 MMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANAWTPCLEFAASDQAYAGNENCITMGPVASTYQDNRYWTMWKLPMFGCTDGSQVLTEIQACTKAFPDAYIRLVCFDANRQVQISGF 163          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS3_ACEAT (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia acetabulum GN=RBCS-3 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.293e-27
Identity = 57/121 (47.11%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  202 MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            M VW P   K FET S+LPPL+DE + K++ Y+L + W PCLEF   ++ +   E+    G     Y D RYWTMWKLPM+GCTDA+QVL E+    K +P +++R++ FD  RQVQ   F
Sbjct:   43 MMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILINSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWTMWKLPMFGCTDASQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGF 163          
The following BLAST results are available for this feature:
BLAST of CX287277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
RBS2_CHLRE2.004e-3143.68Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS_CHLMO2.617e-3147.50Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_CHLRE3.418e-3143.10Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS_SINAL4.936e-3078.87Ribulose bisphosphate carboxylase small chain (Fra... [more]
RBS3_ACECL3.199e-2944.52Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS4_ACECL2.708e-2842.38Ribulose bisphosphate carboxylase small chain 4, c... [more]
RBS5_ACECL3.537e-2840.00Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS_BATOE6.034e-2845.04Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS6_ACECL1.029e-2747.11Ribulose bisphosphate carboxylase small chain 6, c... [more]
RBS3_ACEAT2.293e-2747.11Ribulose bisphosphate carboxylase small chain 3, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006G06SK Veg1 Citrus clementina cDNA clone C01006G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287277 ID=CX287277|Name=CX287277|organism=Citrus clementina|type=EST|length=546bp
AGCTAGAAGAAGGAGCAAGTACCAATGGCTTCCTCAATGATCTCATCGAC
CACCGTTGCCACCGCGAACCGCGCCAGCCTTGCTCAGGCCAGCATGGTCG
CCCCCTTCACCGGCCTCAAGTCTTCTTCTGCTTTCCCAGCAACCAAGAAG
ACCAACAATGACATTACTTCCATTGCAAGCAACGGCGGAAGAGTCCAATG
CATGAAGGTGTGGCCACCAACTGGCTTGAAGAAGTTCGAGACTCTCTCAT
ACCTCCCGCCACTGTCCGATGAAGCTTTGCTCAAGGAAATCAGTTACCTT
CTCCGCTCCGGCTGGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATG
GGTGTACCGTGAGCACCACAGCTCACCAGGATACTACGATGGACGCTACT
GGACAATGTGGAAGCTGCCCATGTATGGGTGCACAGATGCAACCCAGGTT
TTGAAGGAGGTTGGGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCG
AATTATCGGATTTGACAACAAGCGTCAAGTGCAGTGCATCAGTTTC
back to top