CX287332
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_MYCBO (Thioredoxin OS=Mycobacterium bovis GN=trxA PE=3 SV=2) HSP 1 Score: 80.1073 bits (196), Expect = 3.873e-15 Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTDA++ + VL S PVLV+FWA WCGPC+M+ P+++E++ + L K++ D +P A + + SIPT+++FK Sbjct: 12 VTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFK 87
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXB_MYCLE (Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae GN=trxB/A PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.058e-15 Identity = 32/76 (42.11%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTDA++ + VL S PVLV+FWA WCGPC+M+ P+++E++ + +L K++ D +P +A + + SIPT+++F+ Sbjct: 354 VTDASFFADVLSSNKPVLVDFWATWCGPCKMVAPVLEEIASEQRNQLTVAKLDVDTNPEMAREFQVVSIPTMILFQ 429
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_BUCAP (Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum GN=trxA PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.472e-14 Identity = 31/75 (41.33%), Postives = 54/75 (72.00%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 402 +TD ++ VL+ S VLV+FWA WC PC+++ PI++E++++Y K+K K+N +++P+ A Y IR IP +++F Sbjct: 7 LTDQNFEKEVLEHKSFVLVDFWAEWCNPCKILAPILEEIAQEYFNKIKVGKLNIEKNPNTAPIYSIRGIPALLLF 81
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STAS1 (Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.510e-14 Identity = 30/59 (50.85%), Postives = 45/59 (76.27%), Query Frame = 1 Query: 229 LVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 LV+FWA WCGPC+MI P+++EL+ Y GK K++ DE+PS A ++ + SIPT+++FK Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAGDYDGKANILKLDVDENPSTAAKFEVMSIPTLIVFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STAHJ (Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.278e-14 Identity = 30/59 (50.85%), Postives = 45/59 (76.27%), Query Frame = 1 Query: 229 LVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 LV+FWA WCGPC+MI P+++EL+ Y GK K++ DE+PS A ++ + SIPT+++FK Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKFEVMSIPTLIVFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO1_CHLTE (Thioredoxin-1 OS=Chlorobium tepidum GN=trx1 PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.303e-14 Identity = 29/71 (40.85%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 190 TWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 402 T L+ S PV ++FWA WCGPC+M+ P + +L+ ++ G+L KVN D+ P A R+ ++ IP +M+F Sbjct: 4 TLDDLIRTSELPVFIDFWADWCGPCKMVAPSVKQLASEFKGRLIVVKVNVDQQPDAAARFQVQGIPALMLF 74
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO1_SYNY3 (Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803) GN=slr0233 PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.538e-14 Identity = 30/73 (41.10%), Postives = 54/73 (73.97%), Query Frame = 1 Query: 187 ATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 A + ++ S PVLV+F+A WCGPC+M+ PI++++ +++ K++TD+ P+IAT+Y I+S+PT+++FK Sbjct: 8 ANFAEMLAGSPKPVLVDFYATWCGPCQMMAPILEQVGSHLRQQIQVVKIDTDKYPAIATQYQIQSLPTLVLFK 80
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_MYCSM (Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.246e-13 Identity = 34/79 (43.04%), Postives = 55/79 (69.62%), Query Frame = 1 Query: 175 AVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYK--VNTDESPSIATRYGIRSIPTVMIFK 405 AVTD ++ + VL S PVLV+FWA WCGPC+M+ P+++E++ + +L K V+ D +P+ A + + SIPT+++FK Sbjct: 9 AVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDVDANPATARDFQVVSIPTMILFK 87
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_LISMO (Thioredoxin OS=Listeria monocytogenes GN=trxA PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.734e-13 Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 1 Query: 169 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 V +TDAT++ S VL +FWA WCGPCRM+ P+++E+ ++ LK K++ DE+P +G+ SIPT++I K Sbjct: 2 VKEITDATFEQET--SEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKK 78
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_LISIN (Thioredoxin OS=Listeria innocua GN=trxA PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.734e-13 Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 1 Query: 169 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 V +TDAT++ S VL +FWA WCGPCRM+ P+++E+ ++ LK K++ DE+P +G+ SIPT++I K Sbjct: 2 VKEITDATFEQET--SEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKK 78 The following BLAST results are available for this feature:
BLAST of CX287332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 91
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287332 ID=CX287332; Name=CX287332; organism=Citrus clementina; type=EST; length=406bpback to top |