CX287332
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO2_ANASP (Thioredoxin-2 OS=Anabaena sp. (strain PCC 7120) GN=trxB PE=1 SV=3) HSP 1 Score: 72.4034 bits (176), Expect = 8.075e-13 Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = 1 Query: 169 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 V +TDA ++S VL + PVLV FWA WCGPC+++ P+I+ + Y +LK K+ D +P+ +Y + +P + + K Sbjct: 5 VITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVK 83
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: TRXX_ARATH (Thioredoxin-X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 29/79 (36.71%), Postives = 51/79 (64.56%), Query Frame = 1 Query: 169 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 + + ++ + S VL+S PVLVEF A WCGPC++I+P ++ LS++Y KL K++ D +P + + + +P ++FK Sbjct: 71 IKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_BORBU (Thioredoxin OS=Borrelia burgdorferi GN=trxA PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.068e-12 Identity = 25/58 (43.10%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 223 PVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVM 396 P +++F+A WCGPC+M+ PI ++LSK+Y + YKV+TD+ I++ G++S+PT++ Sbjct: 30 PAIIDFYANWCGPCKMLSPIFEKLSKKYENSIDFYKVDTDKEQDISSAIGVQSLPTIL 87
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO2_SYNY3 (Thioredoxin-like protein slr1139 OS=Synechocystis sp. (strain PCC 6803) GN=slr1139 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.068e-12 Identity = 29/76 (38.16%), Postives = 44/76 (57.89%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 +TDA ++ PVLV FWA WCGPCR++ P I ++K Y KLK K+ D +P+ + + +P + +FK Sbjct: 6 ITDAEFEQETQGQTKPVLVYFWASWCGPCRLMAPAIQAIAKDYGDKLKVLKLEVDPNPAAVAQCKVEGVPALRLFK 81
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIOT_DROME (Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = 1 Query: 196 QSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 Q L+L V+++F+A WCGPC++I P +DEL+ +Y ++ KVN DE+ I Y + S+PT + K Sbjct: 13 QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAHEYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIK 82
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: PDIA6_MESAU (Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.787e-11 Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 1 Query: 166 EVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHP----IIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 +V +TD T+ VLDS +VEF+APWCG C+ + P E+ +Q GK+K V+ + +A RYGIR PT+ IF+ Sbjct: 161 DVIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWATAATEVKEQTKGKVKLAAVDATVNQVLANRYGIRGFPTIKIFQ 244
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_TREPA (Thioredoxin OS=Treponema pallidum GN=trxA PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.558e-11 Identity = 23/66 (34.85%), Postives = 44/66 (66.67%), Query Frame = 1 Query: 208 LDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 +++ V+V+FWAPWCG C+M+ P+++E+ + + K+N D+ +A + + SIPT+++FK Sbjct: 15 IETNPLVIVDFWAPWCGSCKMLGPVLEEVESEVGSGVVIGKLNVDDDQDLAVEFNVASIPTLIVFK 80
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_CHLCV (Thioredoxin OS=Chlamydophila caviae GN=trxA PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.871e-11 Identity = 27/60 (45.00%), Postives = 44/60 (73.33%), Query Frame = 1 Query: 226 VLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VL++F+A WCGPC+M+ P+++ L + V + KVN D+ P+ A +YG+ SIPT+++FK Sbjct: 19 VLIDFFAEWCGPCKMLTPVLESLEAE-VSSVLIGKVNIDDHPAPAEQYGVSSIPTLILFK 77
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO2_DROYA (Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.871e-11 Identity = 30/64 (46.88%), Postives = 40/64 (62.50%), Query Frame = 1 Query: 214 SGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 SG V+++F+A WCGPC+MI P + ELS QY + KV+ DE IA Y I S+PT + K Sbjct: 19 SGKLVVLDFFATWCGPCKMISPKLAELSTQYADTVVVLKVDVDECEDIAMEYNISSMPTFVFLK 82
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: PDIA6_RAT (Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.871e-11 Identity = 33/84 (39.29%), Postives = 50/84 (59.52%), Query Frame = 1 Query: 166 EVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHP----IIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 +V +TD T+ VLDS +VEF+APWCG C+ + P E+ +Q GK+K V+ + +A+RYGI+ PT+ IF+ Sbjct: 161 DVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQ 244 The following BLAST results are available for this feature:
BLAST of CX287332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 91
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287332 ID=CX287332; Name=CX287332; organism=Citrus clementina; type=EST; length=406bpback to top |