CX287343
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287343 vs. ExPASy Swiss-Prot
Match: SUMO1_DANRE (Small ubiquitin-related modifier 1 OS=Danio rerio GN=sumo1 PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.117e-13 Identity = 35/69 (50.72%), Postives = 48/69 (69.57%), Query Frame = 1 Query: 193 HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEID 399 +I LKV GQD +E+ F++K +T LKKL +Y RQ V +NS+ FLF+G+R+ TP EL MED D I+ Sbjct: 20 YIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVPVNSLRFLFEGQRITDNLTPKELGMEDEDVIE 88
BLAST of CX287343 vs. ExPASy Swiss-Prot
Match: SUMO1_ONCMY (Small ubiquitin-related modifier 1 OS=Oncorhynchus mykiss GN=sumo1 PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.610e-13 Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = 1 Query: 160 EEDKKPVDQSA-------HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEID 399 + D KP Q +I LKV GQD +E+ F++K +T LKKL +Y RQ V ++++ FLF+G+R+ TP EL MED D I+ Sbjct: 3 DTDTKPSGQDGGDQKDGEYIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVHMSTLRFLFEGQRISDNHTPKELGMEDEDVIE 89 The following BLAST results are available for this feature:
BLAST of CX287343 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287343 ID=CX287343; Name=CX287343; organism=Citrus clementina; type=EST; length=410bpback to top |