CX287359
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287359 vs. ExPASy Swiss-Prot
Match: ROC2_NICPL (31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 6.320e-11 Identity = 29/57 (50.88%), Postives = 45/57 (78.95%), Query Frame = 1 Query: 7 GDITEAKVITERESGKSRGFGFVTYDSNESASSAQSAMDGQELNGRNIRVSFANDRP 177 G++ +AKV+ +R+SG+SRGFGFVTY S + + A +++G +L+GR+IRVS A +RP Sbjct: 232 GNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIDSLNGIDLDGRSIRVSAAEERP 288
BLAST of CX287359 vs. ExPASy Swiss-Prot
Match: GRPA_MAIZE (Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 6.320e-11 Identity = 31/58 (53.45%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 1 NFGDITEAKVITERESGKSRGFGFVTYDSNESASSAQSAMDGQELNGRNIRVSFANDR 174 ++G+I ++KVIT+RE+G+SRGFGFVT+ S S A M+G+EL+GRNI V+ A R Sbjct: 30 SYGEILDSKVITDRETGRSRGFGFVTFSSENSMLDAIENMNGKELDGRNITVNQAQSR 87 The following BLAST results are available for this feature:
BLAST of CX287359 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287359 ID=CX287359; Name=CX287359; organism=Citrus clementina; type=EST; length=434bpback to top |