CX287797
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_ASPFU (Nascent polypeptide-associated complex subunit alpha OS=Aspergillus fumigatus GN=egd2 PE=3 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.948e-15 Identity = 35/55 (63.64%), Postives = 52/55 (94.55%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KLG+K +PG++RVT+++ KNILFVI++PDV++SP+S+T+I+FGEAKIEDL+S Sbjct: 55 AIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNS 109
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_PHANO (Nascent polypeptide-associated complex subunit alpha OS=Phaeosphaeria nodorum GN=EGD2 PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.850e-15 Identity = 36/55 (65.45%), Postives = 51/55 (92.73%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KLG+K I G++RVT+++ KNILFVI++PDV+KSP+S+T+I+FGEAKIEDL+S Sbjct: 57 AIAKLGLKHIDGITRVTLRRPKNILFVINQPDVYKSPSSNTWIIFGEAKIEDLNS 111
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_ASPNC (Nascent polypeptide-associated complex subunit alpha OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd2 PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.567e-15 Identity = 34/55 (61.82%), Postives = 52/55 (94.55%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KLG+K +PG++RVT+++ KNILFVI++PDV++SP+S+T+I+FGEAKIEDL++ Sbjct: 55 AIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNA 109
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA2_HUMAN (Nascent polypeptide-associated complex subunit alpha-2 OS=Homo sapiens GN=NACA2 PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.577e-15 Identity = 39/54 (72.22%), Postives = 46/54 (85.19%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLS 327 AM KLG+ + GV+RVT+ KSKNILFVI+K DV+KSP SD YIVFGEAKI+DLS Sbjct: 79 AMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLS 132
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_AJECN (Nascent polypeptide-associated complex subunit alpha OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=EGD2 PE=3 SV=2) HSP 1 Score: 78.1814 bits (191), Expect = 1.463e-14 Identity = 34/55 (61.82%), Postives = 51/55 (92.73%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KLG+K +PG++RVT+++ K ILFVI++PDV++SP+S+T+I+FGEAKIEDL+S Sbjct: 57 AIGKLGLKHVPGITRVTLRRPKGILFVINQPDVYRSPSSNTWIIFGEAKIEDLNS 111
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_ASPTN (Nascent polypeptide-associated complex subunit alpha OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd2 PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.256e-14 Identity = 33/55 (60.00%), Postives = 51/55 (92.73%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KLG+K +PG++RVT ++ KNILFVI++P+V++SP+S+T+I+FGEAKIEDL++ Sbjct: 55 AIGKLGLKLVPGITRVTFRRPKNILFVINQPEVYRSPSSNTWIIFGEAKIEDLNA 109
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_NEUCR (Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa GN=egd-2 PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.559e-14 Identity = 34/55 (61.82%), Postives = 49/55 (89.09%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KL ++ +PG++RVT+++ KNILFVI+ P+V+KSP S+TYIVFGEAKIEDL++ Sbjct: 58 AIEKLHLQRVPGITRVTLRRPKNILFVINNPEVYKSPNSNTYIVFGEAKIEDLNA 112
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_CHAGB (Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum GN=EGD2 PE=3 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 9.483e-14 Identity = 34/55 (61.82%), Postives = 48/55 (87.27%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KL + +PG++RVT+++ KNILFVI+ P+V+KSP S+TYIVFGEAKIEDL++ Sbjct: 58 AIEKLHLTRVPGITRVTLRRPKNILFVINNPEVYKSPNSNTYIVFGEAKIEDLNA 112
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_GIBZE (Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae GN=EGD2 PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.617e-13 Identity = 34/55 (61.82%), Postives = 48/55 (87.27%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KL + IPG++RVT+++ KNILFVI+ P+V+KSP S+TYIVFGEAKIED+++ Sbjct: 58 ALEKLHLTRIPGITRVTLRRPKNILFVINTPEVYKSPNSNTYIVFGEAKIEDVNA 112
BLAST of CX287797 vs. ExPASy Swiss-Prot
Match: NACA_MAGGR (Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe grisea GN=EGD2 PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.336e-12 Identity = 33/55 (60.00%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 166 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSS 330 A+ KL + + G++RVT+++ KNILFVI+ P+V+KSP S TYIVFGEAKIEDL++ Sbjct: 57 AIEKLHLIRVDGITRVTLRRPKNILFVINNPEVYKSPNSGTYIVFGEAKIEDLNA 111 The following BLAST results are available for this feature:
BLAST of CX287797 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 41
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287797 ID=CX287797; Name=CX287797; organism=Citrus clementina; type=EST; length=332bpback to top |