CX287919
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287919 vs. ExPASy Swiss-Prot
Match: RBS5_ACEAT (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Acetabularia acetabulum GN=RBCS-5 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.688e-11 Identity = 32/74 (43.24%), Postives = 43/74 (58.11%), Query Frame = 2 Query: 191 MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWT 394 M VW P K FET S+LPPL+DE + K++ Y+L + W PCLEF ++ + E+ G Y D RYWT Sbjct: 44 MMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILANSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWT 117
BLAST of CX287919 vs. ExPASy Swiss-Prot
Match: RBS2_ACEAT (Ribulose bisphosphate carboxylase small chain 2, chloroplastic (Fragment) OS=Acetabularia acetabulum GN=RBCS-2 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.688e-11 Identity = 32/74 (43.24%), Postives = 43/74 (58.11%), Query Frame = 2 Query: 191 MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWT 394 M VW P K FET S+LPPL+DE + K++ Y+L + W PCLEF ++ + E+ G Y D RYWT Sbjct: 34 MMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILTNSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWT 107
BLAST of CX287919 vs. ExPASy Swiss-Prot
Match: RBS1_ACEAT (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Acetabularia acetabulum GN=RBCS-1 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.688e-11 Identity = 32/74 (43.24%), Postives = 43/74 (58.11%), Query Frame = 2 Query: 191 MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWT 394 M VW P K FET S+LPPL+DE + K++ Y+L + W PCLEF ++ + E+ G Y D RYWT Sbjct: 43 MMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILTNSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWT 116
BLAST of CX287919 vs. ExPASy Swiss-Prot
Match: RBS3_ACEAT (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia acetabulum GN=RBCS-3 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.703e-11 Identity = 32/74 (43.24%), Postives = 43/74 (58.11%), Query Frame = 2 Query: 191 MKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFEL-EKGWVYREHHSSPG-----YYDGRYWT 394 M VW P K FET S+LPPL+DE + K++ Y+L + W PCLEF ++ + E+ G Y D RYWT Sbjct: 43 MMVWQPFNNKMFETFSFLPPLTDEQISKQVDYILINSWTPCLEFAASDQAYAGNENCIRMGPVASTYQDNRYWT 116 The following BLAST results are available for this feature:
BLAST of CX287919 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 104
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287919 ID=CX287919; Name=CX287919; organism=Citrus clementina; type=EST; length=394bpback to top |