CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_LOTJA (50S ribosomal protein L2, chloroplastic OS=Lotus japonicus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.794e-15 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRRSRKR KYSDNLILRRRTK Sbjct: 236 RAPIGRKKPVTPWGYPALGRRSRKRKKYSDNLILRRRTK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_EUCGG (50S ribosomal protein L2, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.794e-15 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+PATPWGYPALGRRSRKR KYSDNLILRRR+K Sbjct: 236 RAPIGRKKPATPWGYPALGRRSRKRKKYSDNLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2B_SOYBN (50S ribosomal protein L2-B, chloroplastic OS=Glycine max GN=rpl2-B PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.794e-15 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+PATPWG+PALGRRSRKR KYSDNLILRRRTK Sbjct: 236 RAPIGRKKPATPWGFPALGRRSRKRKKYSDNLILRRRTK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2A_SOYBN (50S ribosomal protein L2-A, chloroplastic OS=Glycine max GN=rpl2-A PE=3 SV=2) HSP 1 Score: 80.1073 bits (196), Expect = 3.794e-15 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+PATPWG+PALGRRSRKR KYSDNLILRRRTK Sbjct: 236 RAPIGRKKPATPWGFPALGRRSRKRKKYSDNLILRRRTK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_PLAOC (50S ribosomal protein L2, chloroplastic OS=Platanus occidentalis GN=rpl2-A PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 4.955e-15 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK P TPWGYPALGRRSRKRNKYSD+LILRRRTK Sbjct: 242 RAPIGRKNPTTPWGYPALGRRSRKRNKYSDSLILRRRTK 280
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_HELAN (50S ribosomal protein L2, chloroplastic OS=Helianthus annuus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 4.955e-15 Identity = 35/39 (89.74%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALG+RSRKRNKYSDNLILRRR+K Sbjct: 236 RAPIGRKKPTTPWGYPALGKRSRKRNKYSDNLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_LACSA (50S ribosomal protein L2, chloroplastic OS=Lactuca sativa GN=rpl2-A PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.471e-15 Identity = 35/39 (89.74%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALG+RSRKRNKYSDNLILRRR+K Sbjct: 236 RAPIGRKQPTTPWGYPALGKRSRKRNKYSDNLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_RANMC (50S ribosomal protein L2, chloroplastic OS=Ranunculus macranthus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.452e-15 Identity = 35/39 (89.74%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR+K Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_NANDO (50S ribosomal protein L2, chloroplastic OS=Nandina domestica GN=rpl2-A PE=3 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.452e-15 Identity = 35/39 (89.74%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR+K Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_BUXMI (50S ribosomal protein L2, chloroplastic OS=Buxus microphylla GN=rpl2-A PE=3 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.452e-15 Identity = 35/39 (89.74%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR+K Sbjct: 234 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRRSK 272 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |