CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_PEA (50S ribosomal protein L2, chloroplastic OS=Pisum sativum GN=rpl2 PE=3 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.883e-14 Identity = 34/39 (87.18%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P+TPWGYPALGRR+RK NKYSDNLILRRR+K Sbjct: 235 RAPIGRKKPSTPWGYPALGRRTRKSNKYSDNLILRRRSK 273
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_SPIOL (50S ribosomal protein L2, chloroplastic OS=Spinacia oleracea GN=rpl2-A PE=1 SV=4) HSP 1 Score: 77.411 bits (189), Expect = 2.459e-14 Identity = 34/39 (87.18%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK P TPWGYPALGRRSRKRNKYSDN I+RRR+K Sbjct: 234 RAPIGRKSPTTPWGYPALGRRSRKRNKYSDNFIIRRRSK 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_JASNU (50S ribosomal protein L2, chloroplastic OS=Jasminum nudiflorum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.212e-14 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALG RSRKRNKYS+NLILRRR+K Sbjct: 236 RAPIGRKKPTTPWGYPALGSRSRKRNKYSENLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_SILLA (50S ribosomal protein L2, chloroplastic OS=Silene latifolia GN=rpl2 PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.195e-14 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK P TPWGYPALG+RSRKRNKYSDN I+RRR+K Sbjct: 236 RAPIGRKNPTTPWGYPALGKRSRKRNKYSDNFIIRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_PHAAO (50S ribosomal protein L2, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=rpl2-A PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.195e-14 Identity = 34/37 (91.89%), Postives = 36/37 (97.30%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2B_LIRTU (50S ribosomal protein L2-B, chloroplastic OS=Liriodendron tulipifera GN=rpl2-B PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.195e-14 Identity = 34/37 (91.89%), Postives = 36/37 (97.30%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2A_LIRTU (50S ribosomal protein L2-A, chloroplastic OS=Liriodendron tulipifera GN=rpl2-A PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.195e-14 Identity = 34/37 (91.89%), Postives = 36/37 (97.30%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_PIPCE (50S ribosomal protein L2, chloroplastic OS=Piper cenocladum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.478e-14 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+PATPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 236 RAPIGRKKPATPWGYPALGRRSRKRNKYSDRFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ILLOL (50S ribosomal protein L2, chloroplastic OS=Illicium oligandrum GN=rpl2 PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.478e-14 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRKRP TPWGYPALGRRSRKRNKYSD+ ILRRR Sbjct: 238 RAPIGRKRPTTPWGYPALGRRSRKRNKYSDSFILRRR 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CERDE (50S ribosomal protein L2, chloroplastic OS=Ceratophyllum demersum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.155e-14 Identity = 34/37 (91.89%), Postives = 36/37 (97.30%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+PATPWGYPALGRRSRKR KYSD+LILRRR Sbjct: 236 RAPIGRKKPATPWGYPALGRRSRKRKKYSDSLILRRR 272 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |