CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2B_CHLSC (50S ribosomal protein L2-B, chloroplastic OS=Chloranthus spicatus GN=rpl2-B PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.344e-14 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 R+PIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR Sbjct: 236 RSPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2A_CHLSC (50S ribosomal protein L2-A, chloroplastic OS=Chloranthus spicatus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.344e-14 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 R+PIGRK+P TPWGYPALGRRSRKRNKYSD+LILRRR Sbjct: 238 RSPIGRKKPTTPWGYPALGRRSRKRNKYSDSLILRRR 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_EPIVI (50S ribosomal protein L2, plastid OS=Epifagus virginiana GN=rpl2-A PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.220e-13 Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRRSRK NKYSDN I+RRR+K Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKINKYSDNFIVRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CALFG (50S ribosomal protein L2, chloroplastic OS=Calycanthus floridus var. glaucus GN=rpl2 PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.220e-13 Identity = 33/37 (89.19%), Postives = 35/37 (94.59%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD+ ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_AETGR (50S ribosomal protein L2, chloroplastic OS=Aethionema grandiflora GN=rpl2-A PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.220e-13 Identity = 33/39 (84.62%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+PATPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPATPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_AETCO (50S ribosomal protein L2, chloroplastic OS=Aethionema cordifolium GN=rpl2-A PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.220e-13 Identity = 33/39 (84.62%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+PATPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPATPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ACOCL (50S ribosomal protein L2, chloroplastic OS=Acorus calamus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.594e-13 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDRFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ACOAM (50S ribosomal protein L2, chloroplastic OS=Acorus americanus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.594e-13 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDRFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_SINAL (50S ribosomal protein L2, chloroplastic OS=Sinapis alba GN=rpl2 PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_OLIPU (50S ribosomal protein L2, chloroplastic OS=Olimarabidopsis pumila GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |