CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_NYMAL (50S ribosomal protein L2, chloroplastic OS=Nymphaea alba GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDIFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_NUPAD (50S ribosomal protein L2, chloroplastic OS=Nuphar advena GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDIFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_NASOF (50S ribosomal protein L2, chloroplastic OS=Nasturtium officinale GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_LOBMA (50S ribosomal protein L2, chloroplastic OS=Lobularia maritima GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_LEPVR (50S ribosomal protein L2, chloroplastic OS=Lepidium virginicum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_DRANE (50S ribosomal protein L2, chloroplastic OS=Draba nemorosa GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CRUWA (50S ribosomal protein L2, chloroplastic OS=Crucihimalaya wallichii GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CAPBU (50S ribosomal protein L2, chloroplastic OS=Capsella bursa-pastoris GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ARATH (50S ribosomal protein L2, chloroplastic OS=Arabidopsis thaliana GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ARAHI (50S ribosomal protein L2, chloroplastic OS=Arabis hirsuta GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.551e-13 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |