CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_DRIGR (50S ribosomal protein L2, chloroplastic OS=Drimys granadensis GN=rpl2-A PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.638e-13 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKRNKYSDIYILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_DIOEL (50S ribosomal protein L2, chloroplastic OS=Dioscorea elephantipes GN=rpl2-A PE=3 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.057e-13 Identity = 32/37 (86.49%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRKR KYSD+ ILRRR Sbjct: 237 RAPIGRKKPTTPWGYPALGRRSRKRKKYSDSFILRRR 273
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_BARVE (50S ribosomal protein L2, chloroplastic OS=Barbarea verna GN=rpl2-A PE=3 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.057e-13 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGRR+RKR KYS+ +ILRRR+K Sbjct: 236 RAPIGRKKPVTPWGYPALGRRTRKRKKYSETMILRRRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_IPOPU (50S ribosomal protein L2, chloroplastic OS=Ipomoea purpurea GN=rpl2 PE=3 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 7.911e-13 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGR+SRKRNKYS+ ILR R+K Sbjct: 236 RAPIGRKKPTTPWGYPALGRKSRKRNKYSEKFILRHRSK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_AMBTC (50S ribosomal protein L2, chloroplastic OS=Amborella trichopoda GN=rpl2-A PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.349e-12 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGYPALGRRSRK+ KYSD+ ILRRR Sbjct: 236 RAPIGRKKPTTPWGYPALGRRSRKKKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_MARPO (50S ribosomal protein L2, chloroplastic OS=Marchantia polymorpha GN=rpl2 PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.302e-12 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWG+PALG+RSRK NKYSD LILRRR Sbjct: 238 RAPIGRKKPLTPWGHPALGKRSRKNNKYSDTLILRRR 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_WHEAT (50S ribosomal protein L2, chloroplastic OS=Triticum aestivum GN=rpl2-A PE=3 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_SORBI (50S ribosomal protein L2, chloroplastic OS=Sorghum bicolor GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 234 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 270
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_SACOF (50S ribosomal protein L2, chloroplastic OS=Saccharum officinarum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_SACHY (50S ribosomal protein L2, chloroplastic OS=Saccharum hybrid GN=rpl2-A PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |