CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ORYSJ (50S ribosomal protein L2, chloroplastic OS=Oryza sativa subsp. japonica GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ORYSI (50S ribosomal protein L2, chloroplastic OS=Oryza sativa subsp. indica GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ORYSA (50S ribosomal protein L2, chloroplastic OS=Oryza sativa GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ORYNI (50S ribosomal protein L2, chloroplastic OS=Oryza nivara GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_MAIZE (50S ribosomal protein L2, chloroplastic OS=Zea mays GN=rpl2-A PE=2 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_LOLPR (50S ribosomal protein L2, chloroplastic OS=Lolium perenne GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_HORVU (50S ribosomal protein L2, chloroplastic OS=Hordeum vulgare GN=rpl2-A PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CUSEX (50S ribosomal protein L2, plastid OS=Cuscuta exaltata GN=rpl2 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 31/42 (73.81%), Postives = 35/42 (83.33%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK*ER 127 RAPIGRK+P TPWGYPALGR++RK NKYSD ILR R K +R Sbjct: 236 RAPIGRKKPTTPWGYPALGRKTRKGNKYSDKFILRHRRKQQR 277
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_AGRST (50S ribosomal protein L2, chloroplastic OS=Agrostis stolonifera GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.006e-12 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 +APIGRK+P TPWGYPALGRR+RKR KYSD+ ILRRR Sbjct: 236 KAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_PELHO (50S ribosomal protein L2, chloroplastic OS=Pelargonium hortorum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.926e-12 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 +APIGRK+PATPWG PALG R+RKR KY+DNLILRRR+K Sbjct: 236 KAPIGRKKPATPWGRPALGIRTRKRKKYNDNLILRRRSK 274 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |