CX288197
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_LEMMI (50S ribosomal protein L2, chloroplastic OS=Lemna minor GN=rpl2 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.127e-12 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRKRP TPWGYPALG+RSRK+ +YSD ILRRR Sbjct: 236 RAPIGRKRPMTPWGYPALGKRSRKKKRYSDRFILRRR 272
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_ANEMR (50S ribosomal protein L2, plastid OS=Aneura mirabilis GN=rpl2 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.948e-11 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 + PIGRK+P TPWG+PALGR+SRKR KYSD LILRRR Sbjct: 245 KVPIGRKKPLTPWGHPALGRKSRKRRKYSDTLILRRR 281
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CRYJA (50S ribosomal protein L2, chloroplastic OS=Cryptomeria japonica GN=rpl2 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.324e-11 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRK+P TPWGY ALG++SRKRNKYSD ILRRR Sbjct: 240 RAPIGRKKPLTPWGYSALGKKSRKRNKYSDVSILRRR 276
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CUSRE (50S ribosomal protein L2, plastid OS=Cuscuta reflexa GN=rpl2 PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.341e-11 Identity = 28/39 (71.79%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 118 RAPIGRK+P TPWGYPALGR++RK NKYS+ I+R R K Sbjct: 236 RAPIGRKKPTTPWGYPALGRKTRKVNKYSEKFIIRHRRK 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CHLAT (50S ribosomal protein L2, chloroplastic OS=Chlorokybus atmophyticus GN=rpl2 PE=3 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 4.341e-11 Identity = 28/37 (75.68%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGR +P TPWG+PALG+R+RKRNKYS+ LI+RRR Sbjct: 238 RAPIGRSKPVTPWGHPALGKRTRKRNKYSNALIIRRR 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_STAPU (50S ribosomal protein L2, chloroplastic OS=Staurastrum punctulatum GN=rpl2 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 30/37 (81.08%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 RAPIGRKRP TPWG P LGRRSR R+KYS+ LILRRR Sbjct: 238 RAPIGRKRPLTPWGRPTLGRRSRPRHKYSEALILRRR 274
BLAST of CX288197 vs. ExPASy Swiss-Prot
Match: RK2_CYCTA (50S ribosomal protein L2, chloroplastic OS=Cycas taitungensis GN=rpl2 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = 2 Query: 2 RAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 112 R PIGRK+P TPWGY ALGR+SRK NKYSD ILRRR Sbjct: 239 RTPIGRKKPVTPWGYAALGRKSRKNNKYSDASILRRR 275 The following BLAST results are available for this feature:
BLAST of CX288197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288197 ID=CX288197; Name=CX288197; organism=Citrus clementina; type=EST; length=178bpback to top |