CX288495

Overview
NameCX288495
Unique NameCX288495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length594
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 35/103 (33.98%), Postives = 54/103 (52.43%), Query Frame = 2
Query:  257 EQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            E+L    I  L   + +AGTDTS++  EWA+  ++ N  I +K  +E+   +GK+    E D+  +PYL A+ KE  R+HP     L   +     + GY IP
Sbjct:  287 ERLSITNIKALLLNLFTAGTDTSSSVIEWALTEMMKNPTIFKKAQQEMDQIIGKNRRFIESDIPNLPYLRAICKEAFRKHPSTPLNLPRVSSDACTIDGYYIP 389          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71BZ_ARATH (Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 35/101 (34.65%), Postives = 55/101 (54.46%), Query Frame = 2
Query:  293 SEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDG-LVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYT 592
            S++  AG +  A T  W +  L  +  + +KL +EI A +G +   + EED+EK+ YL  V+ ET R HPP   LL    + D ++ GY+IP    ++  T
Sbjct:  296 SDIFLAGVNGGANTMIWTLTELSRHPRVMKKLQEEIRAMLGPNKERITEEDLEKVEYLKLVMVETFRLHPPAPLLLPRLTMSDIKIQGYNIPKNTMIQINT 396          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71A9_SOYBN (Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 34/113 (30.09%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  242 EPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            +P     + + +I  +  ++  AGTDT++ T  W M  L+ N +  ++  +E+   V    +V+E D+ K+ Y+ +VVKE LR HPP   L+     ++  + G+ IPA   V
Sbjct:  279 DPNQAIAITDDQIKGVLVDIFVAGTDTASATIIWIMSELIRNPKAMKRAQEEVRDLVTGKEMVEEIDLSKLLYIKSVVKEVLRLHPPAPLLVPREITENCTIKGFEIPAKTRV 391          
The following BLAST results are available for this feature:
BLAST of CX288495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
C75A2_SOLME7.972e-1133.98Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C71BZ_ARATH7.972e-1134.65Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=C... [more]
C71A9_SOYBN7.972e-1130.09Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A10SK IF1 Citrus clementina cDNA clone C02001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288495 ID=CX288495|Name=CX288495|organism=Citrus clementina|type=EST|length=594bp
CATACTAAAAGATGTAATGCTGATAACATCACCACAGCTTCCGGATTTCT
TGCCGATTCTCACTCCATTATTTCGCAGGCAAATGAGAGAAGCAAAGGAG
TTGAGGAAGAGACAAATGGAGTGCTTGGTTCCACTGATAAGGAACAGAAA
AGCTTTTGTAGAGAAAGGCCAAAACCCTAACTCAGAGTCAGAGATGGTGA
GTCCAATTGGTGCTGCTTATGTGGATTCATTGTTTGGGCTGGAGCCAACG
GGGAGAGAGCAGCTGGGGGAACAAGAGATTGTGACATTGTGTTCTGAAGT
GATCAGTGCAGGCACTGACACTAGCGCAACAACGGCCGAATGGGCAATGC
ATCACTTGGTGCTAAACCAGGAGATTCAAGAAAAGTTGTATAAAGAAATT
GTAGCTGCTGTGGGGAAAGATGGGCTTGTTAAAGAAGAAGATGTCGAGAA
AATGCCTTATCTCGATGCTGTCGTGAAGGAAACTCTCCGGCGGCACCCTC
CTGGCCATTTTCTGCTGTCTCACGCTGCCATAAAGGATACTGAGCTTGGC
GGGTACTCCATCCCGGCAGGTGTTCACGTGGAATTCTACACTGC
back to top