CX288495

Overview
NameCX288495
Unique NameCX288495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length594
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: TCMO_HELTU (Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.959e-17
Identity = 53/175 (30.29%), Postives = 91/175 (52.00%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            DF+PIL P  R  ++  KE++ ++++        +  FV++ +   S  +M +      +D +  LE   + ++ E  ++ +   +  A  +T+  + EW +  LV + EIQ KL  E+   +G    + E DV+ +PYL AVVKETLR       L+ H  + D +LGG+ IPA
Sbjct:  226 DFIPILRPFLRNYLKLCKEVKDKRIQLF------KDYFVDERKKIGSTKKMDNNQLKCAIDHI--LEAKEKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPA 392          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.959e-17
Identity = 54/149 (36.24%), Postives = 84/149 (56.38%), Query Frame = 2
Query:  122 CLVPLIRNRKAFVE-KGQNPNSESEMVSPIGAAYVDSLFGLEPTGRE-QLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSI 562
            C   L+R  + F++ K    +S++         +VD+L  L+  G E +L   +I  L  ++ +AGTDTS++T EWAM  L+ N +   K   EI   +G++G+V+E D+ K+PYL AVVKET R H P   L+   A  D E+ G+ +
Sbjct:  249 CTERLVRVFRGFIDAKIAEKSSQNNPKDVSKNDFVDNL--LDYKGDESELSISDIEHLLLDMFTAGTDTSSSTLEWAMTELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEILGFMV 395          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.559e-17
Identity = 52/175 (29.71%), Postives = 91/175 (52.00%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            DF+PIL P  R  ++  +E+++R+++        +  FV++ +   S   M +      +D +   +  G  ++ E  ++ +   +  A  +T+  + EW +  LV + EIQ+KL  E+   +G    + E D  K+PYL+AVVKETLR       L+ H  + D +LGG+ IPA
Sbjct:  226 DFIPILRPFLRGYLKICQEVKERRLQLF------KDYFVDERKKLASTKNMCNEGLKCAIDHILDAQKKG--EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPA 392          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.342e-17
Identity = 52/175 (29.71%), Postives = 91/175 (52.00%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            DF+PIL P  R  ++  +E+++R+++        +  FV++ +   S   M +      +D +   +  G  ++ E  ++ +   +  A  +T+  + EW +  LV + EIQ+KL  E+   +G    + E D  K+PYL+AVVKETLR       L+ H  + D +LGG+ IPA
Sbjct:  226 DFIPILRPFLRGYLKICQEVKERRLQLF------KDYFVDERKKLASTKNMSNEGLKCAIDHILDAQKKG--EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPA 392          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C93A1_SOYBN (Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.342e-17
Identity = 58/178 (32.58%), Postives = 92/178 (51.69%), Query Frame = 2
Query:   44 DFLPILTPLFRRQM-REAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGL--EPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            DF+  L P   +   R+ KE R R    +  +I+ R+    K +   +  +    +     D L  +  +     +L ++ I     ++  AGTDTSA + EWAM  L+ N ++ EK  +EI A VGK  +V+E D+  +PYL A+V+ETLR HP G  ++  ++ K   + GY IPA
Sbjct:  220 DFIWYLKPFDLQGFNRKIKETRDRFDVVVDGIIKQRQEERRKNKETGTAKQFKDML-----DVLLDMHEDENAEIKLDKKNIKAFIMDIFVAGTDTSAVSIEWAMAELINNPDVLEKARQEIDAVVGKSRMVEESDIANLPYLQAIVRETLRLHPGGPLVVRESS-KSAVVCGYDIPA 391          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.342e-17
Identity = 57/176 (32.39%), Postives = 90/176 (51.14%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            D++PIL  LF       K+L +   + L  LI +++   E G                 +D L  L+ +  E   +Q I  +   ++ AGT+TSA T EWA+ +L+ + ++  K   EI   VG D L++E D+ ++PYL  +V ETLR HP    L+ H A +D ++G Y +P G
Sbjct:  233 DYVPILR-LFSSYENRVKKLGEETDKFLQGLIDDKRGQQETG--------------TTMIDHLLVLQKSDIEYYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIEEADLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRG 393          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 4.364e-17
Identity = 55/175 (31.43%), Postives = 87/175 (49.71%), Query Frame = 2
Query:   44 DFLPILTPL-FRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            DF+P+L  L F    +  K++  +    L  LI   +   E+                  +D L  L+ +  E   +Q I  L   ++ AGTD+SA T EW+M +L+ + E+ +K+  E+   VG+D LV E D+ K+ YL  V+ ETLR + P   LL H+   +  +GGY +P
Sbjct:  227 DFMPLLRFLDFENLEKRLKDISGKTDAFLRGLIEEHRTKKERANT--------------MIDHLLNLQDSQPEYYTDQIIKGLALAMLLAGTDSSAVTLEWSMSNLLNHPEVLKKVKDELDTHVGQDRLVDESDLPKLTYLKNVINETLRLYTPAPLLLPHSTSDECNIGGYKVP 387          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C79B3_ARATH (Tryptophan N-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.700e-17
Identity = 55/186 (29.57%), Postives = 88/186 (47.31%), Query Frame = 2
Query:   38 LPDFLPILTPL----FRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGL-EPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            + D+LP+LT L      + MRE+  +  +  +   P+I  R     +G+    E          ++D    + +  G+  L   EI     E++ A  D  +   EWA+  ++   EI  K  +EI   VGK+  V+E D+ K+ Y+ A+++E  R HP   F L H A+ DT + GY IP G  V
Sbjct:  255 ISDYLPMLTGLDLNGHEKIMRESSAIMDKYHD---PIIDERIKMWREGKRTQIED---------FLDIFISIKDEAGQPLLTADEIKPTIKELVMAAPDNPSNAVEWAIAEMINKPEILHKAMEEIDRVVGKERFVQESDIPKLNYVKAIIREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQV 428          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.700e-17
Identity = 45/121 (37.19%), Postives = 68/121 (56.20%), Query Frame = 2
Query:  218 YVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            ++DSL  L      +L   +I  L  ++ +AGTDTS++T EWAM  L+ N +   K   E+   +G++ +V+E D+  +PYL AVVKET R HP    L+   A  D E+ G+ +P    V
Sbjct:  281 FLDSLLILNEGDEAELDNNDIEHLLLDMFTAGTDTSSSTLEWAMAELLRNPKTMVKAQAEMDRVLGQNSVVQESDISGLPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQV 401          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: TCMO_PETCR (Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.444e-17
Identity = 51/175 (29.14%), Postives = 90/175 (51.43%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            DF+PIL P  R  ++  +E++ ++++        +  FV++ +   S   + +      +D +   +  G  ++ E  ++ +   +  A  +T+  + EW +  LV N EIQ+KL  E+   +G    + E DV+K+PYL AV+KETLR       L+ H  + D +L GY IPA
Sbjct:  227 DFIPILRPFLRGYLKLCQEIKDKRLKLF------KDYFVDERKKLESIKSVDNNSLKCAIDHIIEAQQKG--EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPEIQKKLRHELDTVLGAGVQICEPDVQKLPYLQAVIKETLRYRMAIPLLVPHMNLHDAKLAGYDIPA 393          
The following BLAST results are available for this feature:
BLAST of CX288495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
TCMO_HELTU1.959e-1730.29Trans-cinnamate 4-monooxygenase OS=Helianthus tube... [more]
C76C1_ARATH1.959e-1736.24Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
TCMO_POPTM2.559e-1729.71Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_POPKI3.342e-1729.71Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]
C93A1_SOYBN3.342e-1732.58Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=... [more]
C81D1_ARATH3.342e-1732.39Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CY... [more]
C81E1_GLYEC4.364e-1731.43Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]
C79B3_ARATH5.700e-1729.57Tryptophan N-hydroxylase 2 OS=Arabidopsis thaliana... [more]
C76C4_ARATH5.700e-1737.19Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
TCMO_PETCR7.444e-1729.14Trans-cinnamate 4-monooxygenase OS=Petroselinum cr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A10SK IF1 Citrus clementina cDNA clone C02001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288495 ID=CX288495|Name=CX288495|organism=Citrus clementina|type=EST|length=594bp
CATACTAAAAGATGTAATGCTGATAACATCACCACAGCTTCCGGATTTCT
TGCCGATTCTCACTCCATTATTTCGCAGGCAAATGAGAGAAGCAAAGGAG
TTGAGGAAGAGACAAATGGAGTGCTTGGTTCCACTGATAAGGAACAGAAA
AGCTTTTGTAGAGAAAGGCCAAAACCCTAACTCAGAGTCAGAGATGGTGA
GTCCAATTGGTGCTGCTTATGTGGATTCATTGTTTGGGCTGGAGCCAACG
GGGAGAGAGCAGCTGGGGGAACAAGAGATTGTGACATTGTGTTCTGAAGT
GATCAGTGCAGGCACTGACACTAGCGCAACAACGGCCGAATGGGCAATGC
ATCACTTGGTGCTAAACCAGGAGATTCAAGAAAAGTTGTATAAAGAAATT
GTAGCTGCTGTGGGGAAAGATGGGCTTGTTAAAGAAGAAGATGTCGAGAA
AATGCCTTATCTCGATGCTGTCGTGAAGGAAACTCTCCGGCGGCACCCTC
CTGGCCATTTTCTGCTGTCTCACGCTGCCATAAAGGATACTGAGCTTGGC
GGGTACTCCATCCCGGCAGGTGTTCACGTGGAATTCTACACTGC
back to top