CX288495

Overview
NameCX288495
Unique NameCX288495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length594
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: TCMO_MEDSA (Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 50/176 (28.41%), Postives = 90/176 (51.14%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGA-AYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            DF+PIL P  +  ++  KE++ R+++        +  FV++ +   S     S  G    +D +   +  G  ++ +  ++ +   +  A  +T+  + EW +  LV +Q+IQ K+ +E+   +G    V E D+ K+PYL AV+KETLR       L+ H  + D +L G+ IPA
Sbjct:  226 DFIPILRPFLKGYLKVCKEVKDRRLQLF------KDYFVDERKKLESTKSTTSNDGLKCAIDHILDAQKKG--EINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQDIQNKVREEMDRVLGPGHQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDPKLNGFDIPA 393          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C80B2_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 46/101 (45.54%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  263 LGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            L + +I  L  E+  AGT+TSA+T EWAM  L  N +I  KL  E+   VG+   VKE D   +PYL+A VKETLR HPP   LL   A++   +  Y+IP
Sbjct:  277 LNDYQINALLMELFGAGTETSASTIEWAMTELTKNPKITAKLRSELQTVVGERS-VKESDFPNLPYLEATVKETLRLHPPTPLLLPRRALETCTILNYTIP 376          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C80B1_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 46/101 (45.54%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  263 LGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            L + +I  L  E+  AGT+TSA+T EWAM  L  N +I  K+  EI   VG+   VKE D   +PYL+A VKETLR HPP   LL   A++   +  Y+IP
Sbjct:  276 LNDYQINALLMELFGAGTETSASTIEWAMTELTKNPKITAKIRSEIQTVVGERS-VKESDFPNLPYLEATVKETLRLHPPTPLLLPRRALETCTILNYTIP 375          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: THAD_ARATH (Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.825e-16
Identity = 51/136 (37.50%), Postives = 77/136 (56.62%), Query Frame = 2
Query:  161 EKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDT-ELGGYSIP 565
            EK Q  +  S+M+  +  AY D           ++   +I +L  ++ SAGT+ SA T +W M  ++ N +I E+L +EI + VGK  LV+E D+  +PYL A+VKE LR HPPG  +      K+T E+ G+ IP
Sbjct:  269 EKLQEHHQTSDMLDMLLEAYGDE------NAEYKITRDQIKSLFVDLFSAGTEASANTIQWTMAEIIKNPKICERLREEIDSVVGKTRLVQETDLPNLPYLQAIVKEGLRLHPPGPVV---RTFKETCEIKGFYIP 395          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_CAVPO (Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.825e-16
Identity = 49/176 (27.84%), Postives = 86/176 (48.86%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            DF+PIL  L    M   K+L +R    +  +I+      EKG   +    ++       +D    +      Q+ +Q+I+ +  ++  AG DT  T   W++ +LV+N  IQ+K+ +E+   +G++   +  D  K+PY++A + E  R      F + H+  KDT L G+ IP G
Sbjct:  231 DFIPILRYLPSATMDTFKDLNRRFSVFIQKMIKEHYKTFEKGHIRDITDSLIEHCQDRKLDKNANI------QISDQKIIGIVLDLFGAGFDTITTAISWSLLYLVMNPRIQKKIQEELDTVIGRERQPQLADRPKLPYMEAFISEVFRYSSFMPFTIPHSTTKDTSLNGFYIPKG 400          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71AK_ARATH (Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 46/122 (37.70%), Postives = 72/122 (59.02%), Query Frame = 2
Query:  221 VDSLFGLEP--TGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            VD L  ++   TG+ +L +  +  +  ++  AGT T+ +  EWAM  L+ N ++ +KL +EI ++  +D  V E++ EKM YL AV+KE LR  PP   L+     +D +L GY+IPAG  V
Sbjct:  269 VDKLLTIQSDKTGQFELEKSALKLIIWDMFLAGTATTLSFLEWAMTELMRNPKVMKKLQEEIRSSSPQDLFVTEKEAEKMNYLQAVIKEALRLRPPAPLLVPRVLSEDVKLKGYNIPAGTQV 390          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_CANFA (Cytochrome P450 1A1 OS=Canis familiaris GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.231e-16
Identity = 49/176 (27.84%), Postives = 85/176 (48.30%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            DF PIL  L    +   K+L KR    +  +++      EKGQ  +    ++       +D    +      QL +++IV +  ++  AG DT  T   W++ +LV N  +Q+K+ KE+   +G+    +  D  ++PY++A + ET R      F + H+  +DT L G+ IP G
Sbjct:  239 DFFPILRYLPNPALDFFKDLNKRFYSFMQKMVKEHYKTFEKGQIRDVTDSLIEHCQDKRLDENANI------QLSDEKIVNVVLDLFGAGFDTVTTAISWSLLYLVTNPNVQKKIQKELDTVIGRARQPRLSDRPQLPYMEAFILETFRHASFVPFTIPHSTTRDTSLSGFYIPKG 408          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71C1_MAIZE (Cytochrome P450 71C1 OS=Zea mays GN=CYP71C1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.231e-16
Identity = 40/94 (42.55%), Postives = 57/94 (60.64%), Query Frame = 2
Query:  299 VISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            +  A  +TS    E++M  L+ N+ +  KL KE+  A     +V EED+ +MPYL A +KE++R HPP  FLL H +  D E+ GY+IPAG  V
Sbjct:  324 MFEAAIETSFLVLEYSMSELMNNRHVLAKLQKEVRTATPDGRMVMEEDLSRMPYLKATIKESMRIHPPAPFLLPHFSTHDCEINGYTIPAGTRV 417          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71A8_MENPI (Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.231e-16
Identity = 62/198 (31.31%), Postives = 97/198 (48.99%), Query Frame = 2
Query:    2 ILKDVM-LITSPQLPDFLPILTPLFRRQM--REAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGL--EPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            IL++ + L+ +  + DF+P L  + R     R    + K   E L  +I  R       +NP +++E        +VD L  +    +    +    I  +  +V +AGTDT+A   EWAM  L+ + EI +KL  E+   V     + ++D+EKM YL AV+KET+R H P   L+   A  D E+ GY +P G  V
Sbjct:  213 ILREFLELLGAISIGDFVPSLWWINRINGFDRRVDRIAKEMDEFLEKVIHERL------ENPAAKAE------ENFVDILLEIYRNNSAGVSIDRDSIKAIILDVFAAGTDTTAVVLEWAMTELLRHPEIMKKLQSEVRQVVKDKHNITDDDIEKMHYLKAVMKETMRFHTPIPLLVPRVARNDVEVMGYDVPVGTMV 398          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.075e-15
Identity = 44/104 (42.31%), Postives = 62/104 (59.62%), Query Frame = 2
Query:  260 QLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            +L + EI  L   +  AGTDTS++T EWA+  L+ N +I  +  +EI   VG+D LV E D+ ++ YL+A+VKET R HP     L   A +  E+ GY IP G
Sbjct:  288 KLTDTEIKALLLNLFVAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGRDRLVGELDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKG 391          
The following BLAST results are available for this feature:
BLAST of CX288495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
TCMO_MEDSA3.695e-1628.41Trans-cinnamate 4-monooxygenase OS=Medicago sativa... [more]
C80B2_ESCCA3.695e-1645.54(S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS... [more]
C80B1_ESCCA3.695e-1645.54(S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (F... [more]
THAD_ARATH4.825e-1637.50Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=C... [more]
CP1A1_CAVPO4.825e-1627.84Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 P... [more]
C71AK_ARATH6.302e-1637.70Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=C... [more]
CP1A1_CANFA8.231e-1627.84Cytochrome P450 1A1 OS=Canis familiaris GN=CYP1A1 ... [more]
C71C1_MAIZE8.231e-1642.55Cytochrome P450 71C1 OS=Zea mays GN=CYP71C1 PE=2 S... [more]
C71A8_MENPI8.231e-1631.31Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8... [more]
F3PH_PETHY1.075e-1542.31Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A10SK IF1 Citrus clementina cDNA clone C02001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288495 ID=CX288495|Name=CX288495|organism=Citrus clementina|type=EST|length=594bp
CATACTAAAAGATGTAATGCTGATAACATCACCACAGCTTCCGGATTTCT
TGCCGATTCTCACTCCATTATTTCGCAGGCAAATGAGAGAAGCAAAGGAG
TTGAGGAAGAGACAAATGGAGTGCTTGGTTCCACTGATAAGGAACAGAAA
AGCTTTTGTAGAGAAAGGCCAAAACCCTAACTCAGAGTCAGAGATGGTGA
GTCCAATTGGTGCTGCTTATGTGGATTCATTGTTTGGGCTGGAGCCAACG
GGGAGAGAGCAGCTGGGGGAACAAGAGATTGTGACATTGTGTTCTGAAGT
GATCAGTGCAGGCACTGACACTAGCGCAACAACGGCCGAATGGGCAATGC
ATCACTTGGTGCTAAACCAGGAGATTCAAGAAAAGTTGTATAAAGAAATT
GTAGCTGCTGTGGGGAAAGATGGGCTTGTTAAAGAAGAAGATGTCGAGAA
AATGCCTTATCTCGATGCTGTCGTGAAGGAAACTCTCCGGCGGCACCCTC
CTGGCCATTTTCTGCTGTCTCACGCTGCCATAAAGGATACTGAGCTTGGC
GGGTACTCCATCCCGGCAGGTGTTCACGTGGAATTCTACACTGC
back to top