CX288495

Overview
NameCX288495
Unique NameCX288495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length594
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_MACMU (Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.075e-15
Identity = 47/176 (26.70%), Postives = 84/176 (47.73%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            DF+PIL  L  R +   K+L ++    +  +I+      EKG   +    ++       +D    +      QL +++IV +  ++  AG DT  T   W++ +LV N  +Q K+ +E+   +G+    +  D   +PY++A + ET R      F + H+  +DT L G+ IP G
Sbjct:  235 DFIPILRYLPNRSLNGFKDLNEKFHSFMQKMIKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANI------QLSDEKIVNVVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKG 404          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_MACFA (Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.404e-15
Identity = 47/176 (26.70%), Postives = 84/176 (47.73%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            DF+PIL  L  R +   K+L ++    +  +I+      EKG   +    ++       +D    +      QL +++IV +  ++  AG DT  T   W++ +LV N  +Q K+ +E+   +G+    +  D   +PY++A + ET R      F + H+  +DT L G+ IP G
Sbjct:  235 DFIPILRYLPNRSLNGFKDLNEKFHSFMQKMIKEHYKTFEKGYIRDITDSLIEHCQEKQLDENANI------QLSDEKIVNVVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKG 404          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_HUMAN (Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 44/176 (25.00%), Postives = 83/176 (47.16%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            DF+PIL  L    +   K+L ++    +  +++      EKG   +    ++       +D           QL +++I+ +  ++  AG DT  T   W++ +LV+N  +Q K+ +E+   +G+    +  D   +PY++A + ET R      F + H+  +DT L G+ IP G
Sbjct:  235 DFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDE------NANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKG 404          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP10_LYMST (Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 42/108 (38.89%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  263 LGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGK-DGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVE 583
            +  +E+  L  +++ A  +T+++   W +++L  N ++QEKL++EI  A  K +G +  ED+ K+P + AVVKETLR +P   +  S    +D ELGGY+IPAG HV+
Sbjct:  336 MSTKEVTGLIVDLMLAAVETTSSATVWCLYNLAKNPQVQEKLFQEITEAQAKNNGTISAEDLCKLPMVKAVVKETLRLYPI-TYSTSRNIAEDMELGGYTIPAGTHVQ 442          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C79A2_ARATH (Phenylalanine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 43/110 (39.09%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  251 GREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            G+  L ++EI    +E++ A  D  +  AEW M  ++    I +K  +EI   VGKD LV E D+  + Y+ A VKE  R HP   F L H +  DT + GY IP G HV
Sbjct:  307 GKPTLSDEEIKAQVTELMLATVDNPSNAAEWGMAEMINEPSIMQKAVEEIDRVVGKDRLVIESDLPNLNYVKACVKEAFRLHPVAPFNLPHMSTTDTVVDGYFIPKGSHV 416          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71B8_ARATH (Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 42/137 (30.66%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  185 ESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDG-LVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYT 592
            +S+  S + ++ +D +      G  ++    ++ + ++++  G +    T  W M  L  +  + +KL +EI A +G +   + EED+EK+ YL  V+KET R HPPG FLL    + D E+ GY IP   H++  T
Sbjct:  262 QSQDHSNLVSSMLDMINRSTEYGSFKITSDHLIAMMTDIVLGGVNAGTITMIWTMTELTRHPRVMKKLREEIRATLGPNKERITEEDLEKVEYLKLVIKETFRLHPPGPFLLPRQVMSDIEIQGYHIPKNAHIKIST 398          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C79A1_SORBI (Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3)

HSP 1 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 40/122 (32.79%), Postives = 65/122 (53.28%), Query Frame = 2
Query:  218 YVDSLFGLEPT-GREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            ++D L  L+   G   L  +E+     ++  A  D  +   EWA+  +V N E+  K  +E+   VG++ LV+E D+ K+ Y+ A ++E  R HP   F + H A+ DT + GY +P G HV
Sbjct:  320 FLDVLITLKDAQGNPLLTIEEVKAQSQDITFAAVDNPSNAVEWALAEMVNNPEVMAKAMEELDRVVGRERLVQESDIPKLNYVKACIREAFRLHPVAPFNVPHVALADTTIAGYRVPKGSHV 441          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71DC_CATRO (Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 38/102 (37.25%), Postives = 62/102 (60.78%), Query Frame = 2
Query:  263 LGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPA 568
            LG++ I  +   + SAGT+TS+TT +WAM  ++ N  + +K  +E+     ++G V E  + ++ YL AV+KETLR HPP   LL     +  ++ GY+IP+
Sbjct:  282 LGDKNIKAIIFNIFSAGTETSSTTVDWAMCEMIKNPTVMKKAQEEVRKVFNEEGNVDETKLHQLKYLQAVIKETLRLHPPVPLLLPRECREQCKIKGYTIPS 383          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_PLAFE (Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.128e-15
Identity = 50/174 (28.74%), Postives = 82/174 (47.13%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            DF+PIL  L    M+    +  R  E +  ++       +K    +    ++       +D           Q+ +++IV + +++  AG DT +T   W++ +LV + EIQE+LY+EI   VG D +    D   +P+L+A + E LR      F + H   KDT L GY IP
Sbjct:  240 DFIPILQYLPSAAMKNFLRINSRFTEFVQKIVTEHYTTFDKDNIRDITDSLIDHCEDRKLDE------NSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGLDRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIP 407          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A2_MACFA (Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 53/174 (30.46%), Postives = 86/174 (49.43%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            DF PIL  L    ++  K   +R    L   ++      +K    NS  ++    GA +  S  G   +G   + +++IV L +++  AG DT AT   W++ +LV   EIQ K+ KE+ A +G+    +  D  ++PYL+A + ET R      F + H+  +DT L G+ IP
Sbjct:  237 DFFPILRYLPNPALQRFKAFNQRFRRFLQKTVQEHYQDFDK----NSVQDIT---GALFKHSKKGPRASGN-LIPQEKIVNLVNDIFGAGFDTIATAISWSLMYLVTKPEIQRKIQKELDAVIGRGRRPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTTLNGFYIP 402          
The following BLAST results are available for this feature:
BLAST of CX288495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
CP1A1_MACMU1.075e-1526.70Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE... [more]
CP1A1_MACFA1.404e-1526.70Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1... [more]
CP1A1_HUMAN1.834e-1525.00Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1... [more]
CP10_LYMST1.834e-1538.89Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 P... [more]
C79A2_ARATH1.834e-1539.09Phenylalanine N-hydroxylase OS=Arabidopsis thalian... [more]
C71B8_ARATH1.834e-1530.66Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CY... [more]
C79A1_SORBI2.395e-1532.79Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP... [more]
C71DC_CATRO2.395e-1537.25Tabersonine 16-hydroxylase (Fragment) OS=Catharant... [more]
CP1A1_PLAFE3.128e-1528.74Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a... [more]
CP1A2_MACFA5.335e-1530.46Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A10SK IF1 Citrus clementina cDNA clone C02001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288495 ID=CX288495|Name=CX288495|organism=Citrus clementina|type=EST|length=594bp
CATACTAAAAGATGTAATGCTGATAACATCACCACAGCTTCCGGATTTCT
TGCCGATTCTCACTCCATTATTTCGCAGGCAAATGAGAGAAGCAAAGGAG
TTGAGGAAGAGACAAATGGAGTGCTTGGTTCCACTGATAAGGAACAGAAA
AGCTTTTGTAGAGAAAGGCCAAAACCCTAACTCAGAGTCAGAGATGGTGA
GTCCAATTGGTGCTGCTTATGTGGATTCATTGTTTGGGCTGGAGCCAACG
GGGAGAGAGCAGCTGGGGGAACAAGAGATTGTGACATTGTGTTCTGAAGT
GATCAGTGCAGGCACTGACACTAGCGCAACAACGGCCGAATGGGCAATGC
ATCACTTGGTGCTAAACCAGGAGATTCAAGAAAAGTTGTATAAAGAAATT
GTAGCTGCTGTGGGGAAAGATGGGCTTGTTAAAGAAGAAGATGTCGAGAA
AATGCCTTATCTCGATGCTGTCGTGAAGGAAACTCTCCGGCGGCACCCTC
CTGGCCATTTTCTGCTGTCTCACGCTGCCATAAAGGATACTGAGCTTGGC
GGGTACTCCATCCCGGCAGGTGTTCACGTGGAATTCTACACTGC
back to top