CX288495

Overview
NameCX288495
Unique NameCX288495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length594
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_LIMLI (Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 50/174 (28.74%), Postives = 82/174 (47.13%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            DF+PIL  L    M+    +  R  E +  ++       +K    +    ++       +D           Q+ +++IV + +++  AG DT +T   W++ +LV + EIQE+LY+EI   VG D +    D   +P+L+A + E LR      F + H   KDT L GY IP
Sbjct:  240 DFIPILQYLPSATMKNFLRINGRFTEFVQKIVTEHYTTFDKDNIRDITDSLIDHCEDRKLDE------NSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGLDRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIP 407          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_BALAC (Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 46/176 (26.14%), Postives = 86/176 (48.86%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            DF+PIL  L    + + K+L +R    +  +++      EKG+  +    ++       +D    +      QL +++IV +  ++  AG DT  T   W++ +LV +  +Q+K+ +E+   +G     +  D  ++PYL+A + ET R      F + H+  +DT L G+ IP G
Sbjct:  239 DFIPILRYLPNTALDDFKDLNRRFYIFMQKMLKEHYKTFEKGRIRDITDSLIEHCQGKRLDENANI------QLSDEKIVNVVMDLFGAGFDTVTTAISWSLMYLVTSPSVQKKIQEELDTVIGSARQPRLSDRPRLPYLEAFILETFRHSSFLPFTIPHSTTRDTSLNGFYIPKG 408          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C513C_DICDI (Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513c1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 52/189 (27.51%), Postives = 90/189 (47.62%), Query Frame = 2
Query:   20 LITSPQLPDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAV--GKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            L++ P +  + PIL+P    + +E  ++ K     ++ LI   K   +  Q      +  +      +D L  L      ++ +  ++++C +V+ AGTDT   T  +A+  LV N EIQEKL + I+ ++  G +     +    +PYL  VVKE  R +P G   L H   +D E+ G+ I  G  +
Sbjct:  212 LVSQPSITTYFPILSPFMNDRSKEFYDIHKLLSNHIINLIERYKDSKQHQQQEQEPIDGATEPTVTILDKL--LIEVENNRITQNALISICIDVLIAGTDTVGQTLSFAIVALVNNAEIQEKLSRNIIDSMEKGDNHYSYSKYRNGIPYLALVVKEVFRMYPAGILGLPHMTSEDCEIQGHKIAKGTQI 398          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_PLEPL (Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.968e-15
Identity = 49/174 (28.16%), Postives = 82/174 (47.13%), Query Frame = 2
Query:   44 DFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            DF+PIL  L   +M+    + +   E +  ++        K    +    ++       +D           Q+ +++IV + +++  AG DT +T   W++ +LV + EIQE+LY+EI   VG D +    D   +P+L+A + E LR      F + H   KDT L GY IP
Sbjct:  240 DFIPILQYLPSAEMKNFLRINEHFTEFVQKIVTEHYTTFNKDNIRDITDSLIDHCEDRKLDE------NSNVQMSDEKIVGIVNDLFGAGFDTVSTALSWSVMYLVAHPEIQERLYQEIEDKVGLDRMPLLSDKPNLPFLEAFILEILRHSSFLPFTIPHCTTKDTSLNGYFIP 407          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71BW_ARATH (Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.968e-15
Identity = 43/120 (35.83%), Postives = 65/120 (54.17%), Query Frame = 2
Query:  218 YVDSLFGLEPT----GREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            +VD L  LE      G ++L    I  +  +V+ AG DTSA T  WAM  L  N  + +K+  EI   +G   ++  ED++++ YL  V+KET R HP    LL   A+ + ++ GY+IP
Sbjct:  266 FVDLLLRLEKEEAVLGNDKLTRNHIKAILLDVLLAGIDTSAITMTWAMTELARNPRVMKKVQSEIRTQMGNRSMISFEDMDQLEYLKMVIKETWRLHPTTPLLLPREAMSEFDINGYTIP 385          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71BU_ARATH (Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.968e-15
Identity = 43/132 (32.58%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  200 SPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDG-LVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYT 592
            S +  A +D +      G  ++    ++ + S+V+ AG +    T  W M  L  +  + +KL +EI A +G +   + EED+EK+ YL+ V+KE+ R HPP   LL    + D E+ GY IP   HV+  T
Sbjct:  265 SDLVTAMLDVINRPRKFGSLKITYDHLIAMMSDVVLAGVNAGTVTMIWTMTELTRHPRVMKKLQEEIRATLGPNKERITEEDLEKVEYLNLVIKESFRLHPPAPLLLPRETMSDIEIQGYHIPKNAHVKINT 396          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71AM_ARATH (Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.968e-15
Identity = 40/107 (37.38%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  260 QLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            ++    I  +  +V+  GTDTS    EWAM  L+   E   +L +E+      +  V E+D++ M YL AV+KET+R HPP   ++ H + +D  LG Y IPAG  V
Sbjct:  276 EIDRLSIKAIILDVVVGGTDTSYALMEWAMTELLHRPECLNRLQEEVRTICKGNSSVSEDDIKDMNYLKAVIKETMRLHPPLPLMVPHESTQDVRLGDYHIPAGTQV 382          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71B3_ARATH (Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 9.100e-15
Identity = 46/135 (34.07%), Postives = 72/135 (53.33%), Query Frame = 2
Query:  170 QNPNSESEMVSP-IGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVG--KDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIP 565
            +NP  ++    P I  + +++++  E     +L    +  +   +  AG DTSA T  WAM  LV N  + +K  +EI   +G  +   ++EEDV+K+ YL  V+KETLR HPP   LL    + D ++ GY IP
Sbjct:  257 KNPEDKTNQDRPDIIDSILETIYKQEQDESFKLTIDHLKGIIQNIYLAGVDTSAITMIWAMAELVKNPRVMKKAQEEIRTCIGIKQKERIEEEDVDKLQYLKLVIKETLRLHPPAPLLLPRETMADIKIQGYDIP 391          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C71AQ_ARATH (Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.100e-15
Identity = 43/123 (34.96%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  218 YVDSLFGLE--PTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            +VD L  ++   T   ++    I  +   V   GTDTS+T  EWAM  L+ + +  ++L +E+         V EE+++ M YL AV+KE LR HPP   ++ H + +D  LG + IPAG  V
Sbjct:  259 FVDVLLAIQRDKTVGFEINRVSIKAIVMNVFVGGTDTSSTLMEWAMTELLRHPKCLKRLQEEVRTICKDKSSVSEEEIQNMSYLKAVIKEALRLHPPLPLMVPHESTQDVRLGDHHIPAGTQV 381          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: CP1A1_MESAU (Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.188e-14
Identity = 46/177 (25.99%), Postives = 81/177 (45.76%), Query Frame = 2
Query:   41 PDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG 571
            PDF+PIL  L    +   K+L K+    +   ++      EKG   +    ++       +D           QL +  ++ +  ++  AG DT  T   W++ +LV N  +Q K+ +E+   +G+    +  D  ++PYL+A + ET R      F + H+  +DT L G+ IP G
Sbjct:  238 PDFIPILRYLPNSSLDAFKDLNKKFYSFMQKSVKEHYRTFEKGHIRDITDSLIEHCQDKSLDE------NANVQLSDDRVINIIVDLFGAGFDTVTTAISWSLMYLVTNPGVQRKIQEELDTVIGRSRRPRLCDRSQLPYLEAFILETFRHSSFLPFTIPHSTTRDTSLCGFYIPKG 408          
The following BLAST results are available for this feature:
BLAST of CX288495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
CP1A1_LIMLI5.335e-1528.74Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 P... [more]
CP1A1_BALAC5.335e-1526.14Cytochrome P450 1A1 OS=Balaenoptera acutorostrata ... [more]
C513C_DICDI5.335e-1527.51Probable cytochrome P450 513C1 OS=Dictyostelium di... [more]
CP1A1_PLEPL6.968e-1528.16Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cy... [more]
C71BW_ARATH6.968e-1535.83Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=C... [more]
C71BU_ARATH6.968e-1532.58Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=C... [more]
C71AM_ARATH6.968e-1537.38Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=C... [more]
C71B3_ARATH9.100e-1534.07Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CY... [more]
C71AQ_ARATH9.100e-1534.96Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=C... [more]
CP1A1_MESAU1.188e-1425.99Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A10SK IF1 Citrus clementina cDNA clone C02001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288495 ID=CX288495|Name=CX288495|organism=Citrus clementina|type=EST|length=594bp
CATACTAAAAGATGTAATGCTGATAACATCACCACAGCTTCCGGATTTCT
TGCCGATTCTCACTCCATTATTTCGCAGGCAAATGAGAGAAGCAAAGGAG
TTGAGGAAGAGACAAATGGAGTGCTTGGTTCCACTGATAAGGAACAGAAA
AGCTTTTGTAGAGAAAGGCCAAAACCCTAACTCAGAGTCAGAGATGGTGA
GTCCAATTGGTGCTGCTTATGTGGATTCATTGTTTGGGCTGGAGCCAACG
GGGAGAGAGCAGCTGGGGGAACAAGAGATTGTGACATTGTGTTCTGAAGT
GATCAGTGCAGGCACTGACACTAGCGCAACAACGGCCGAATGGGCAATGC
ATCACTTGGTGCTAAACCAGGAGATTCAAGAAAAGTTGTATAAAGAAATT
GTAGCTGCTGTGGGGAAAGATGGGCTTGTTAAAGAAGAAGATGTCGAGAA
AATGCCTTATCTCGATGCTGTCGTGAAGGAAACTCTCCGGCGGCACCCTC
CTGGCCATTTTCTGCTGTCTCACGCTGCCATAAAGGATACTGAGCTTGGC
GGGTACTCCATCCCGGCAGGTGTTCACGTGGAATTCTACACTGC
back to top