CX288506
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288506 vs. ExPASy Swiss-Prot
Match: NUOB_AQUAE (NADH-quinone oxidoreductase subunit B OS=Aquifex aeolicus GN=nuoB PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 8.254e-11 Identity = 25/42 (59.52%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 16 SYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKMNRR 141 +YS ++G DRI+PVD+Y+PGCPPT + L+YGILQLQ+K+ + Sbjct: 109 TYSTLQGVDRIIPVDVYIPGCPPTPQGLIYGILQLQRKIKEQ 150
BLAST of CX288506 vs. ExPASy Swiss-Prot
Match: NUOB_AMOA5 (NADH-quinone oxidoreductase subunit B OS=Amoebophilus asiaticus (strain 5a2) GN=nuoB PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 8.254e-11 Identity = 27/46 (58.70%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 4 YYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKMNRR 141 Y+ + Y VV+G DRI+PVD+YVPGCPP EAL+ GIL+LQ+K+ + Sbjct: 111 YWQHGYHVVKGVDRIIPVDVYVPGCPPRPEALIGGILKLQEKIKAK 156 The following BLAST results are available for this feature:
BLAST of CX288506 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 242
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288506 ID=CX288506; Name=CX288506; organism=Citrus clementina; type=EST; length=432bpback to top |