CX288851
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288851 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.576e-12 Identity = 31/57 (54.39%), Postives = 43/57 (75.44%), Query Frame = 1 Query: 67 FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPV 237 FDPLGLA DP++ A+L++ E+K+ RLAM + GF VQA TGKGP+ N H++DP+ Sbjct: 223 FDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPL 279
BLAST of CX288851 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.259e-11 Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 1 Query: 67 FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPV 237 FDPLGLA DP + A+L++ E+K+ RLAM GF VQA TGKGP+ N H++DP+ Sbjct: 220 FDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPL 276 The following BLAST results are available for this feature:
BLAST of CX288851 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288851 ID=CX288851; Name=CX288851; organism=Citrus clementina; type=EST; length=566bpback to top |