CX291092
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX291092 vs. ExPASy Swiss-Prot
Match: TRPB_PSEA6 (Tryptophan synthase beta chain OS=Pseudoalteromonas atlantica (strain T6c / BAA-1087) GN=trpB PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.125e-11 Identity = 38/85 (44.71%), Postives = 49/85 (57.65%), Query Frame = 3 Query: 243 VPETLMYALSELESALHKLADDRDFQEELSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQA 497 VPE L+ AL +LE A +D +FQ+E +L DY GR T + + L + PN +YLKREDL H GAHK N +GQA Sbjct: 16 VPELLIPALDQLEQAFIDAQNDPEFQKEFMELLTDYAGRPTAMTLSRNLVSN---PN---VKLYLKREDLLHGGAHKTNQVLGQA 94
BLAST of CX291092 vs. ExPASy Swiss-Prot
Match: TRPB_HELPY (Tryptophan synthase beta chain OS=Helicobacter pylori GN=trpB PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.125e-11 Identity = 37/85 (43.53%), Postives = 49/85 (57.65%), Query Frame = 3 Query: 243 VPETLMYALSELESALHKLADDRDFQEELSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQA 497 V E L+ AL ELE A D FQ+E +L+D+VGR +PL + + + + +YLKREDL H GAHK N A+GQA Sbjct: 15 VSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLCQNIVSNPK------VKLYLKREDLIHGGAHKTNQALGQA 93
BLAST of CX291092 vs. ExPASy Swiss-Prot
Match: TRPB_ERWCT (Tryptophan synthase beta chain OS=Erwinia carotovora subsp. atroseptica GN=trpB PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.125e-11 Identity = 37/85 (43.53%), Postives = 48/85 (56.47%), Query Frame = 3 Query: 243 VPETLMYALSELESALHKLADDRDFQEELSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQA 497 VP+ L+ AL +LE A D +FQ E + +L++Y GR T L + LT G +YLKREDL H GAHK N +GQA Sbjct: 16 VPQILIPALRQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALTLCKNLTA------GTKTKLYLKREDLLHGGAHKTNQVLGQA 94
BLAST of CX291092 vs. ExPASy Swiss-Prot
Match: TRPB_BUCDN (Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpB PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.125e-11 Identity = 38/85 (44.71%), Postives = 47/85 (55.29%), Query Frame = 3 Query: 243 VPETLMYALSELESALHKLADDRDFQEELSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQA 497 VP+ LM AL ELE + D +F + +L++Y GR TPL LT+ G IYLKREDL H GAHK N +GQA Sbjct: 16 VPQILMPALLELEKNFVEAQKDINFHKTFFNLLKNYAGRPTPLTLCNNLTK------GTKTRIYLKREDLLHGGAHKTNQVLGQA 94 The following BLAST results are available for this feature:
BLAST of CX291092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 324
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX291092 ID=CX291092; Name=CX291092; organism=Citrus clementina; type=EST; length=497bpback to top |