CX292198
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAAR (Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAAN (Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAAM (Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAAC (Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAAB (Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 33/83 (39.76%), Postives = 55/83 (66.27%), Query Frame = 2 Query: 251 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEKH 493 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ + ++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX292198 vs. ExPASy Swiss-Prot
Match: THIOM_BOVIN (Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 8.621e-11 Identity = 34/83 (40.96%), Postives = 54/83 (65.06%), Query Frame = 2 Query: 248 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLQRIVGAK-KDELQLAVEK 490 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+ + VG K +D+L+ ++K Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKVVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKK 163 The following BLAST results are available for this feature:
BLAST of CX292198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX292198 ID=CX292198; Name=CX292198; organism=Citrus clementina; type=EST; length=713bpback to top |