CX293877

Overview
NameCX293877
Unique NameCX293877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig872 contig Ccv1_Contig872:40..548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_SOLPE (17.7 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.120e-43
Identity = 94/158 (59.49%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTN-VFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIP IFG RR++ +FDP S+DV+DPF       L    +++ ETS FAN RIDWKET +AHVFKADLPGL+           R+LQISGER+ E E+KNDKW RV+RSSGKF+RRFRLP+NAK++QVKASMENGVLTVT            +IEIS
Sbjct:    1 MSLIPRIFGDRRSSSMFDPFSIDVFDPF-----RELGFPGTNSGETSAFANTRIDWKETPEAHVFKADLPGLKLEEVKVEVEEDRVLQISGERNMEKEDKNDKWQRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPKEEMKKPDVKSIEIS 153          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS16C_ORYSJ (16.9 kDa class I heat shock protein 3 OS=Oryza sativa subsp. japonica GN=HSP16.9C PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.120e-43
Identity = 89/147 (60.54%), Postives = 108/147 (73.47%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RR+NVFDP + D WDPFDG   S +    +S R+T+ FANAR+DWKET ++HVFKADLPG++          G +L ISG+RSKE E+KNDKWHRV+RSSG+F+RRFRLP+NAKV+QVKASMENGVLTVT            AIEIS
Sbjct:    5 RRSNVFDPFA-DFWDPFDGVFRSLVP--ATSDRDTAAFANARVDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSSGQFMRRFRLPENAKVDQVKASMENGVLTVTVPKAEVKKPEVKAIEIS 148          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_SOLLC (17.8 kDa class I heat shock protein OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 7.257e-43
Identity = 93/160 (58.13%), Postives = 114/160 (71.25%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTN-VFDPVSLDVWDPFD--GFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIP IFG RR++ +FDP S+DV+DPF   GF S+       ++ E+S FAN RIDWKET + HVFK DLPGL+           R+LQISGER+ E E+KNDKWHR++RSSGKF+RRFRLP+NAK++QVKASMENGVLTVT            +IEIS
Sbjct:    1 MSLIPRIFGDRRSSSMFDPFSIDVFDPFRELGFPST-------NSGESSAFANTRIDWKETPEPHVFKVDLPGLKKEEVKVEVEEDRVLQISGERNVEKEDKNDKWHRMERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPKEEVKKPEVKSIEIS 153          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS177_ORYSJ (17.7 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.7 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.238e-42
Identity = 89/154 (57.79%), Postives = 105/154 (68.18%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGF-------LSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RR N FDP SLD+WDP DGF        SS+ +  P +  + + FA ARIDWKET + HVFKAD+PGL+          G ILQISGERS+E EEK+DKWHRV+RSSGKFLRRFRLP+N K EQ+KASMENGVLTVT            +I+IS
Sbjct:    5 RRGNAFDPFSLDLWDPVDGFPFGSGGSSSSSGSLFPRANSDAAAFAGARIDWKETPEVHVFKADVPGLKKEEVKVEVDDGNILQISGERSREQEEKSDKWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVTVPKEEPKKPDVKSIQIS 158          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS17B_ARATH (17.6 kDa class I heat shock protein 2 OS=Arabidopsis thaliana GN=HSP17.6B PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.111e-42
Identity = 88/158 (55.70%), Postives = 108/158 (68.35%), Query Frame = 2
Query:   38 MSLIPSIFGG-RRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MS+IPS F   RR+N+FDP SLDVWDPF    SS+L+      RE S   NAR+DW+ET +AHVFKADLPGL+            +L+ISGER  E E+KND WHRV+RSSG+F RRFRLP+N K++QVKA+MENGVLTVT            +I+IS
Sbjct:    1 MSMIPSFFNNNRRSNIFDPFSLDVWDPFKELTSSSLS------RENSAIVNARVDWRETPEAHVFKADLPGLKKEEVKVEIEEDSVLKISGERHVEKEDKNDTWHRVERSSGQFTRRFRLPENVKMDQVKAAMENGVLTVTVPKAETKKADVKSIQIS 152          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_MEDSA (18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.513e-40
Identity = 83/142 (58.45%), Postives = 102/142 (71.83%), Query Frame = 2
Query:   86 DPVSLDVWDPFDGF-LSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            DP SLDVWDPF  F  +++  +A S  +E S F + RIDWKET +AHVFKADLPGL+           R+LQISGER+ E E+KND+WHRV+RSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT            +IEIS
Sbjct:    1 DPFSLDVWDPFKDFPFTNSALSASSFPQENSAFVSTRIDWKETPEAHVFKADLPGLKKEEVKVEIEDDRVLQISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEIKKPEVKSIEIS 142          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS16A_WHEAT (16.9 kDa class I heat shock protein 1 OS=Triticum aestivum GN=hsp16.9A PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.581e-40
Identity = 86/148 (58.11%), Postives = 106/148 (71.62%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVW-DPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RR+NVFDP + D+W DPFD F S     +  S+ ET+ FANAR+DWKET +AHVFK DLPG++          G +L +SGERS+E E+KNDKWHRV+RSSGKF+RRFRLP++AKVE+VKA +ENGVLTVT            AIEIS
Sbjct:    5 RRSNVFDPFA-DLWADPFDTFRSIVPAISGGSS-ETAAFANARVDWKETPEAHVFKVDLPGVKKEEVKVEVEDGNVLVVSGERSREKEDKNDKWHRVERSSGKFVRRFRLPEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKAIEIS 150          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS178_ARATH (17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.371e-40
Identity = 84/142 (59.15%), Postives = 100/142 (70.42%), Query Frame = 2
Query:   38 MSLIPSIFGGRR--TNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            MSLIPS FG  R   ++FDP SLDVWDPF       L    S + ETS   NAR+DWKETA+AHVFKADLPG++            +L+ISGER  E EEK D WHRV+RSSG+F R+F+LP+N K++QVKASMENGVLTVT
Sbjct:    1 MSLIPSFFGNNRRSNSIFDPFSLDVWDPF-----KELQFPSSLSGETSAITNARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQFSRKFKLPENVKMDQVKASMENGVLTVT 137          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS17A_ARATH (17.6 kDa class I heat shock protein 1 OS=Arabidopsis thaliana GN=HSP17.6A PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 5.750e-40
Identity = 86/143 (60.14%), Postives = 100/143 (69.93%), Query Frame = 2
Query:   38 MSLIPSIFGGRR---TNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            MSLIPS FG  R    N+FDP SLDVWDPF           PSS+  +S  ANAR+DWKETA+AHVFKADLPG++            +L+ISGER  E EEK D WHRV+RSSG F R+FRLP+N K++QVKASMENGVLTVT
Sbjct:    1 MSLIPSFFGNNRRINNNIFDPFSLDVWDPFKEL------QFPSSS--SSAIANARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGGFSRKFRLPENVKMDQVKASMENGVLTVT 135          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS16B_WHEAT (16.9 kDa class I heat shock protein 2 OS=Triticum aestivum GN=hsp16.9B PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.185e-39
Identity = 85/148 (57.43%), Postives = 104/148 (70.27%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVW-DPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RRTNVFDP + D+W DPFD F  S +        ET+ FANAR+DWKET +AHVFKADLPG++          G +L +SGER+KE E+KNDKWHRV+RSSGKF+RRFRL ++AKVE+VKA +ENGVLTVT            AI+IS
Sbjct:    5 RRTNVFDPFA-DLWADPFDTF-RSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKAIQIS 150          
The following BLAST results are available for this feature:
BLAST of CX293877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP11_SOLPE1.120e-4359.4917.7 kDa class I heat shock protein OS=Solanum per... [more]
HS16C_ORYSJ1.120e-4360.5416.9 kDa class I heat shock protein 3 OS=Oryza sat... [more]
HSP11_SOLLC7.257e-4358.1317.8 kDa class I heat shock protein OS=Solanum lyc... [more]
HS177_ORYSJ1.238e-4257.7917.7 kDa class I heat shock protein OS=Oryza sativ... [more]
HS17B_ARATH2.111e-4255.7017.6 kDa class I heat shock protein 2 OS=Arabidops... [more]
HSP11_MEDSA1.513e-4058.4518.1 kDa class I heat shock protein (Fragment) OS=... [more]
HS16A_WHEAT2.581e-4058.1116.9 kDa class I heat shock protein 1 OS=Triticum ... [more]
HS178_ARATH3.371e-4059.1517.8 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17A_ARATH5.750e-4060.1417.6 kDa class I heat shock protein 1 OS=Arabidops... [more]
HS16B_WHEAT2.185e-3957.4316.9 kDa class I heat shock protein 2 OS=Triticum ... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A02SK FlavRip1 Citrus clementina cDNA clone C05002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293877 ID=CX293877|Name=CX293877|organism=Citrus clementina|type=EST|length=509bp
GTTGTTGAGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTC
CAAGCATCTTCGGGGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTA
GATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGC
GCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACT
GGAAAGAGACTGCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTG
AGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGAT
AAGCGGCGAGAGGAGCAAGGAGCATGAAGAGAAGAATGACAAGTGGCATC
GCGTCCAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGAC
AATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCAC
AGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTG
AGATCTCTG
back to top