CX293877

Overview
NameCX293877
Unique NameCX293877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig872 contig Ccv1_Contig872:40..548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP21_SOLPE (17.3 kDa class II heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.092e-14
Identity = 42/106 (39.62%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  146 NAPSS--ARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            NAPS    R+    A    D KE   ++VF  D+PGL+            +L ISGER +E E++  K+ R++R  GKF+R+F LP+NA  + + A  ++GVLTVT
Sbjct:   30 NAPSKIYVRDAKAMAATPADVKEYPNSYVFVVDMPGLKSGDIKVQVEEDNVLLISGERKREEEKEGAKFIRMERRVGKFMRKFSLPENANTDAISAVCQDGVLTVT 135          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP22_MAIZE (17.8 kDa class II heat shock protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 7.078e-14
Identity = 49/125 (39.20%), Postives = 65/125 (52.00%), Query Frame = 2
Query:   98 LDVWDPFDGFLSSALTNAPSSA-----RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            LDV D   G      T +  SA     R+    A    D KE   A+ F  D+PGL            R+L +SGER +E  E + K+ R++R  GKF+R+F LPDNA V++V A   +GVLTVT
Sbjct:   20 LDVPDGDAGAGGDNKTGSGGSATRTYVRDARAMAATPADVKELPGAYAFVVDMPGLGTGDIRVQVEDERVLVVSGERRREEREDDAKYLRMERRMGKFMRKFVLPDNADVDKVAAVCRDGVLTVT 144          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP23_MAIZE (17.0 kDa class II heat shock protein OS=Zea mays GN=HSP18 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.059e-13
Identity = 43/98 (43.88%), Postives = 58/98 (59.18%), Query Frame = 2
Query:  164 RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            R+    A    D KE A A+ F  D+PGL            R+L ISGER +E E ++ K+ R++R  GKF+R+F LPDNA V++V A   +GVLTVT
Sbjct:   38 RDARAMAATPADVKELAGAYAFVVDMPGLSTGDIRVQVEDERVLVISGERRRE-EREDAKYLRMERRMGKFMRKFVLPDNADVDKVAAVCRDGVLTVT 134          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP21_PEA (17.1 kDa class II heat shock protein OS=Pisum sativum GN=HSP17.7 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.690e-13
Identity = 39/106 (36.79%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  146 NAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            NAP+    R+    A    D KE   ++VF  D+PG++            +L ISGER +E E++  K+ +++R  GK +R+F LP+NA +E + A  ++GVLTVT
Sbjct:   27 NAPTRTYVRDAKAMAATPADVKEHPNSYVFMVDMPGVKSGDIKVQVEDENVLLISGERKREEEKEGVKYLKMERRIGKLMRKFVLPENANIEAISAISQDGVLTVT 132          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP21_HELAN (17.9 kDa class II heat shock protein OS=Helianthus annuus GN=HSP17.9 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 5.992e-13
Identity = 38/106 (35.85%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  146 NAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            + PS A  R+    A    D KE   ++VF  D+PGL+            +L ISG+R++E E++  K+ R++R  GKF+++F LP++A  +++ A  ++GVLTVT
Sbjct:   35 SGPSRAYVRDARAMAATPADVKECPNSYVFIVDMPGLKSGDIKVQVERDNVLVISGKRNREEEKEGVKYVRMERRMGKFMKKFALPEDANTDKISAICQDGVLTVT 140          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP18_ORYSJ (18.0 kDa class II heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.0 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 5.992e-13
Identity = 43/111 (38.74%), Postives = 64/111 (57.66%), Query Frame = 2
Query:  143 TNAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSK----EHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            T  P+ A  R+    A    D K+   A+ F  D+PGL+           R+L ISGER +    E +E++ K+ R++R  GKF+R+F LPDNA V+++ A  ++GVLTVT
Sbjct:   36 TGGPTRAYVRDARAMAATPADVKDLPGAYAFVVDMPGLKSSDIKVQVEEERLLVISGERRRGGGEEEKEESCKYLRMERRMGKFMRKFVLPDNADVDKISAVCQDGVLTVT 146          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP21_SOYBN (17.9 kDa class II heat shock protein OS=Glycine max GN=HSP17.9-D PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.022e-12
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  119 DGFLSSALTNAP--SSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            DG   +   NAP  S  R+    A    D KE   ++VF+ D+PGL+            +L I GER ++ E++  K+ R++R  GK +R+F LP+NA  + + A  ++GVL+VT
Sbjct:   25 DGAGDNKTHNAPTWSYVRDAKAMAATPADVKEYPNSYVFEIDMPGLKSGDIKVQVEDDNLLLICGERKRDEEKEGAKYLRMERRVGKLMRKFVLPENANTDAISAVCQDGVLSVT 139          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: SP21_STIAU (Spore protein SP21 OS=Stigmatella aurantiaca GN=hspA PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.335e-12
Identity = 45/135 (33.33%), Postives = 72/135 (53.33%), Query Frame = 2
Query:   68 RRTNVFDPVS----LDVWDPFDGFLSSALTNAPSSARETSQFANA-RIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            +RT  +DP      L  WDPF+      L N P  A      A     + +ET +A++FKADLPG+            R+  +SG+R +E  E++++++  +R+ G F R F LP+    + V+A ++NGVLT+T
Sbjct:   15 QRTREWDPFQQMQELMNWDPFE------LANHPWFANRQGPPAFVPAFEVRETKEAYIFKADLPGVDEKDIEVTLTGDRV-SVSGKREREKREESERFYAYERTFGSFSRAFTLPEGVDGDNVRADLKNGVLTLT 142          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP21_IPONI (17.2 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.277e-12
Identity = 43/111 (38.74%), Postives = 63/111 (56.76%), Query Frame = 2
Query:  134 SALTNAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKND-KWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            S+ ++APS     +    A    D KE   ++VF  D+PGL+            +L ISGER +E EEK   K+ R++R  GK +R+F LP+NA  E++ A  ++GVLTVT
Sbjct:   25 SSNSSAPSRTFMLDAKAMAATPADVKEYPNSYVFIIDMPGLKSGDIKVQVDGDNVLSISGERKREAEEKEGAKYVRMERRVGKLMRKFVLPENANKEKITAVCQDGVLTVT 135          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP22_IPONI (18.8 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-2 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.884e-12
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 2
Query:  164 RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKND--KWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            R+    A    D KE   ++VF AD+PG++            +L +SGER++  +++ D  K+ R++R  GKF+R+F LP+NA VE + A  ++GVL VT
Sbjct:   48 RDAKAMAATPADVKEYPNSYVFIADMPGVKAAEIKVQVEDDNVLVVSGERTEREKDEKDGVKYLRMERRVGKFMRKFVLPENANVEAINAVYQDGVLQVT 147          
The following BLAST results are available for this feature:
BLAST of CX293877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP21_SOLPE1.092e-1439.6217.3 kDa class II heat shock protein OS=Solanum pe... [more]
HSP22_MAIZE7.078e-1439.2017.8 kDa class II heat shock protein OS=Zea mays P... [more]
HSP23_MAIZE2.059e-1343.8817.0 kDa class II heat shock protein OS=Zea mays G... [more]
HSP21_PEA2.690e-1336.7917.1 kDa class II heat shock protein OS=Pisum sati... [more]
HSP21_HELAN5.992e-1335.8517.9 kDa class II heat shock protein OS=Helianthus... [more]
HSP18_ORYSJ5.992e-1338.7418.0 kDa class II heat shock protein OS=Oryza sati... [more]
HSP21_SOYBN1.022e-1234.7817.9 kDa class II heat shock protein OS=Glycine ma... [more]
SP21_STIAU1.335e-1233.33Spore protein SP21 OS=Stigmatella aurantiaca GN=hs... [more]
HSP21_IPONI2.277e-1238.7417.2 kDa class II heat shock protein OS=Ipomoea ni... [more]
HSP22_IPONI3.884e-1237.0018.8 kDa class II heat shock protein OS=Ipomoea ni... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A02SK FlavRip1 Citrus clementina cDNA clone C05002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293877 ID=CX293877|Name=CX293877|organism=Citrus clementina|type=EST|length=509bp
GTTGTTGAGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTC
CAAGCATCTTCGGGGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTA
GATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGC
GCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACT
GGAAAGAGACTGCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTG
AGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGAT
AAGCGGCGAGAGGAGCAAGGAGCATGAAGAGAAGAATGACAAGTGGCATC
GCGTCCAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGAC
AATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCAC
AGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTG
AGATCTCTG
back to top