CX295134
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295134 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.910e-11 Identity = 27/76 (35.53%), Postives = 51/76 (67.11%), Query Frame = 2 Query: 326 DSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGA 553 DSG ++++F A WCGPCR+I P + EL+K++ + +KV+ D+ +A Y + ++P+ +I K G++ + ++GA Sbjct: 25 DSGKLIVIDFTASWCGPCRVITPYVSELAKKF-PHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGA 99
BLAST of CX295134 vs. ExPASy Swiss-Prot
Match: TRX2_YEAST (Thioredoxin-2 OS=Saccharomyces cerevisiae GN=TRX2 PE=1 SV=3) HSP 1 Score: 68.1662 bits (165), Expect = 4.910e-11 Identity = 30/84 (35.71%), Postives = 53/84 (63.10%), Query Frame = 2 Query: 308 WQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVP 559 + S + V+V+F+A WCGPC+MI P+I++ ++QY YK++ DE +A + + S+PT++ +K G++ V+GA P Sbjct: 11 YDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANP 93
BLAST of CX295134 vs. ExPASy Swiss-Prot
Match: PDIA4_HUMAN (Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11 Identity = 31/89 (34.83%), Postives = 52/89 (58.43%), Query Frame = 2 Query: 284 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGK--LKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTV 544 V V T+ S+V+D VL+EF+APWCG C+ + P+ + L+K+Y G+ L K++ + + RY + PT+ +G+KK+ V Sbjct: 527 VKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPV 615 The following BLAST results are available for this feature:
BLAST of CX295134 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 123
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295134 ID=CX295134; Name=CX295134; organism=Citrus clementina; type=EST; length=698bpback to top |