CX296442
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296442 vs. ExPASy Swiss-Prot
Match: UBIQ_LEIMA (Ubiquitin OS=Leishmania major GN=UB-EP52 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.169e-11 Identity = 33/38 (86.84%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 1 EAITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 114 + I LEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGK Sbjct: 11 KTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGK 48
BLAST of CX296442 vs. ExPASy Swiss-Prot
Match: UBIQ_PHYIN (Ubiquitin OS=Phytophthora infestans PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.604e-11 Identity = 32/38 (84.21%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 1 EAITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 114 + ITL+VE SD+IDNVK KIQDKEGIPPDQQRLIFAGK Sbjct: 11 KTITLDVEPSDSIDNVKQKIQDKEGIPPDQQRLIFAGK 48
BLAST of CX296442 vs. ExPASy Swiss-Prot
Match: UBIQ_LEITA (Ubiquitin OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.894e-11 Identity = 32/36 (88.89%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 7 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK 114 I LEVE SDTI+NVKAKIQDKEGIPPDQQRLIFA K Sbjct: 13 IALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFADK 48 The following BLAST results are available for this feature:
BLAST of CX296442 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296442 ID=CX296442; Name=CX296442; organism=Citrus clementina; type=EST; length=116bpback to top |