CX296597
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_LEIMA (Ubiquitin OS=Leishmania major GN=UB-EP52 PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.592e-14 Identity = 34/55 (61.82%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+ L+VE SDT++N +A QDKEGIPPDQQ +IFAG +E+ RTL+DYN++ E Sbjct: 10 GKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_LUMTE (Ubiquitin (Fragment) OS=Lumbricus terrestris PE=1 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 9.538e-14 Identity = 34/53 (64.15%), Postives = 44/53 (83.02%), Query Frame = 1 Query: 19 TLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 T+TL+VE SDT++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 1 TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 53
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_LEITA (Ubiquitin OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.799e-12 Identity = 32/55 (58.18%), Postives = 43/55 (78.18%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 G T+ L+VE SDT++N +A QDKEGIPPDQQ +IFA +E+ RTL+DYN++ E Sbjct: 10 GTTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFADKQLEEGRTLSDYNIQKE 64 The following BLAST results are available for this feature:
BLAST of CX296597 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296597 ID=CX296597; Name=CX296597; organism=Citrus clementina; type=EST; length=406bpback to top |