CX296642
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX296642 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2) HSP 1 Score: 45.4394 bits (106), Expect = 4.088e-12 Identity = 20/47 (42.55%), Postives = 28/47 (59.57%), Query Frame = -2 Query: 225 GYGLTTNIINGGIECGYVGNDAVRNRIGFFTTFCGKFGIQPGDNLDC 365 G+G T ING +EC + AV RI ++ +CG+ G+ PG NL C Sbjct: 223 GFGATIRAING-MECNGGNSGAVNARIRYYRDYCGQLGVDPGPNLSC 268 HSP 2 Score: 41.2022 bits (95), Expect = 4.088e-12 Identity = 17/46 (36.96%), Postives = 30/46 (65.22%), Query Frame = -1 Query: 439 LEFNY-YGAEKPRVGEELLNNPDLLATDPVLSFKSAIWFWMTAQPP 573 L +NY YGA + LL P+L++++P ++F++ +WFWM + P Sbjct: 173 LSWNYNYGACGQSLNLNLLGQPELVSSNPTVAFRTGLWFWMNSVRP 218 HSP 3 Score: 24.6386 bits (52), Expect = 4.088e-12 Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = -2 Query: 567 RGPIQLSWN 593 RGPIQLSWN Sbjct: 168 RGPIQLSWN 176
BLAST of CX296642 vs. ExPASy Swiss-Prot
Match: AGI_URTDI (Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE=1 SV=3) HSP 1 Score: 68.5514 bits (166), Expect = 2.931e-11 Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = -1 Query: 412 PRSNSTLLEFNYYGAEKPRVGEELLNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVII 594 PR L YG +GE+L+ NPDL+ DP++SFK+A+WFWM+ KPSCH++++ Sbjct: 238 PRGPIQLTHNFNYGLAGQAIGEDLIQNPDLVEKDPIISFKTALWFWMSQHDNKPSCHDIVL 298 The following BLAST results are available for this feature:
BLAST of CX296642 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 52
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296642 ID=CX296642; Name=CX296642; organism=Citrus clementina; type=EST; length=609bpback to top |