CX297710
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_NYMAL (50S ribosomal protein L2, chloroplastic OS=Nymphaea alba GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 32/36 (88.89%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 120 APIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 237 APIGRKKPTTPWGYPALGRRSRKRNKYSDIFILRRR 272
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_NUPAD (50S ribosomal protein L2, chloroplastic OS=Nuphar advena GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 32/36 (88.89%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 120 APIGRK+P TPWGYPALGRRSRKRNKYSD ILRRR Sbjct: 237 APIGRKKPTTPWGYPALGRRSRKRNKYSDIFILRRR 272
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_NASOF (50S ribosomal protein L2, chloroplastic OS=Nasturtium officinale GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_LOBMA (50S ribosomal protein L2, chloroplastic OS=Lobularia maritima GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_LEPVR (50S ribosomal protein L2, chloroplastic OS=Lepidium virginicum GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_DRANE (50S ribosomal protein L2, chloroplastic OS=Draba nemorosa GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_CRUWA (50S ribosomal protein L2, chloroplastic OS=Crucihimalaya wallichii GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_CAPBU (50S ribosomal protein L2, chloroplastic OS=Capsella bursa-pastoris GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_ARATH (50S ribosomal protein L2, chloroplastic OS=Arabidopsis thaliana GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_ARAHI (50S ribosomal protein L2, chloroplastic OS=Arabis hirsuta GN=rpl2-A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.391e-12 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRRTK 126 APIGRK+P TPWGYPALGRR+RKR KYS+ LILRRR+K Sbjct: 237 APIGRKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK 274 The following BLAST results are available for this feature:
BLAST of CX297710 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297710 ID=CX297710; Name=CX297710; organism=Citrus clementina; type=EST; length=186bpback to top |