CX297710
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_LEMMI (50S ribosomal protein L2, chloroplastic OS=Lemna minor GN=rpl2 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.008e-11 Identity = 29/36 (80.56%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 13 APIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 120 APIGRKRP TPWGYPALG+RSRK+ +YSD ILRRR Sbjct: 237 APIGRKRPMTPWGYPALGKRSRKKKRYSDRFILRRR 272
BLAST of CX297710 vs. ExPASy Swiss-Prot
Match: RK2_ANEMR (50S ribosomal protein L2, plastid OS=Aneura mirabilis GN=rpl2 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.622e-11 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 10 EAPIGRKRPATPWGYPALGRRSRKRNKYSDNLILRRR 120 + PIGRK+P TPWG+PALGR+SRKR KYSD LILRRR Sbjct: 245 KVPIGRKKPLTPWGHPALGRKSRKRRKYSDTLILRRR 281 The following BLAST results are available for this feature:
BLAST of CX297710 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297710 ID=CX297710; Name=CX297710; organism=Citrus clementina; type=EST; length=186bpback to top |