CX297929
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_LISMC (Ribosome-recycling factor OS=Listeria monocytogenes serotype 4b (strain Clip81459) GN=frr PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 8.178e-12 Identity = 33/46 (71.74%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 LLI PYDK+ L IEKAI+ SDLG+TPNNDG V+RL++PQLT ERR Sbjct: 65 LLITPYDKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTEERR 110
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_LISIN (Ribosome-recycling factor OS=Listeria innocua GN=frr PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 8.178e-12 Identity = 33/46 (71.74%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 LLI PYDK+ L IEKAI+ SDLG+TPNNDG V+RL++PQLT ERR Sbjct: 65 LLITPYDKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTEERR 110
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_GEOTN (Ribosome-recycling factor OS=Geobacillus thermodenitrificans (strain NG80-2) GN=frr PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11 Identity = 32/46 (69.57%), Postives = 40/46 (86.96%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 L+IQPYDKS +K +EKAI++SDLG+TP+NDG VIRL +P LT ERR Sbjct: 65 LVIQPYDKSVIKEMEKAILASDLGVTPSNDGSVIRLVIPPLTEERR 110
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_CLOK5 (Ribosome-recycling factor OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=frr PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.822e-11 Identity = 32/46 (69.57%), Postives = 40/46 (86.96%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 L IQP+DKS+LKSIEKAI+ SDLG+ P+NDGE+IRL +P+LT E R Sbjct: 65 LAIQPWDKSALKSIEKAILKSDLGINPSNDGEIIRLIIPELTEETR 110
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_CLOK1 (Ribosome-recycling factor OS=Clostridium kluyveri (strain NBRC 12016) GN=frr PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.822e-11 Identity = 32/46 (69.57%), Postives = 40/46 (86.96%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 L IQP+DKS+LKSIEKAI+ SDLG+ P+NDGE+IRL +P+LT E R Sbjct: 65 LAIQPWDKSALKSIEKAILKSDLGINPSNDGEIIRLIIPELTEETR 110
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_SYNP2 (Ribosome-recycling factor OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=frr PE=3 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 2.189e-11 Identity = 28/46 (60.87%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 ++IQP+D+ SL +E+AI SDLG+TPNNDG IRL +P LT ERR Sbjct: 62 IMIQPFDRGSLSDVERAISMSDLGLTPNNDGTNIRLNIPPLTKERR 107 HSP 2 Score: 25.7942 bits (55), Expect = 2.189e-11 Identity = 11/20 (55.00%), Postives = 14/20 (70.00%), Query Frame = 3 Query: 135 RKEELSKVVAKQAEEGKVVM 194 R++EL K K AEEGKV + Sbjct: 106 RRQELVKTAGKLAEEGKVAL 125
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_MICAN (Ribosome-recycling factor OS=Microcystis aeruginosa (strain NIES-843) GN=frr PE=3 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 2.189e-11 Identity = 27/46 (58.70%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 + IQP+D++S+ +IEKAI SD+G+TP+NDG+ IRL +P LTS+RR Sbjct: 62 IAIQPFDRTSMGAIEKAISLSDVGLTPSNDGQTIRLNIPPLTSDRR 107 HSP 2 Score: 26.9498 bits (58), Expect = 2.189e-11 Identity = 12/20 (60.00%), Postives = 16/20 (80.00%), Query Frame = 3 Query: 135 RKEELSKVVAKQAEEGKVVM 194 R++EL K+ AK AEEGKV + Sbjct: 106 RRKELVKLAAKLAEEGKVAI 125
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_THEEB (Ribosome-recycling factor OS=Thermosynechococcus elongatus (strain BP-1) GN=frr PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.379e-11 Identity = 32/46 (69.57%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 +LIQPYD+S+L SIEKAI SDLG+TPNNDG +RL +P LT+ERR Sbjct: 62 ILIQPYDRSTLASIEKAIQLSDLGLTPNNDGSSVRLNIPPLTTERR 107
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_LACDB (Ribosome-recycling factor OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=frr PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.379e-11 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 L+I PYDKSSL IE AI++SDLG+TP NDG VIRL +PQLT ERR Sbjct: 65 LMITPYDKSSLNDIEHAILASDLGLTPANDGNVIRLIIPQLTGERR 110
BLAST of CX297929 vs. ExPASy Swiss-Prot
Match: RRF_CYAA5 (Ribosome-recycling factor OS=Cyanothece sp. (strain ATCC 51142) GN=frr PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.108e-11 Identity = 31/46 (67.39%), Postives = 38/46 (82.61%), Query Frame = 1 Query: 7 LLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERR 144 ++IQPYDK S+ IEKAI SD+G+TPNNDG+VIRL +P LT ERR Sbjct: 62 IMIQPYDKGSMGQIEKAIQMSDVGLTPNNDGQVIRLNIPPLTEERR 107 The following BLAST results are available for this feature:
BLAST of CX297929 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 46
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297929 ID=CX297929; Name=CX297929; organism=Citrus clementina; type=EST; length=731bpback to top |