CX299891
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299891 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.747e-13 Identity = 35/57 (61.40%), Postives = 43/57 (75.44%), Query Frame = 3 Query: 3 DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 173 DPLGLA DPE A+L++ EIK+ RLAM + GF VQA TGKGPL N A HL+DP++ Sbjct: 224 DPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280
BLAST of CX299891 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.077e-12 Identity = 34/57 (59.65%), Postives = 41/57 (71.93%), Query Frame = 3 Query: 3 DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 173 DPLGLA DP A+L++ EIK+ RLAM GF VQA TGKGPL N A HL+DP++ Sbjct: 221 DPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277 The following BLAST results are available for this feature:
BLAST of CX299891 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299891 ID=CX299891; Name=CX299891; organism=Citrus clementina; type=EST; length=355bpback to top |