CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADB_PHOPR (Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.064e-11
Identity = 36/82 (43.90%), Postives = 49/82 (59.76%), Query Frame = 2
Query:    5 LACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            LA D R+    A +GLPET L I+PG GGT RLPRL+G   A +II  G+    +DA+ LGLV+  V     +  AL + ++
Sbjct:  122 LATDFRLADITARIGLPETRLGIMPGFGGTVRLPRLLGADSAMEIITAGKDKKAQDALKLGLVDAVVAPTALKDAALSMIKD 203          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADB_IDILO (Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis GN=fadB PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.064e-11
Identity = 34/81 (41.98%), Postives = 46/81 (56.79%), Query Frame = 2
Query:    5 LACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQ 247
            LACD R+    A +GLPE  L +IPG GGT RLPR++G   A + I TG+     DA+ +G V+  V        AL +A+
Sbjct:  121 LACDYRVADTTATIGLPEVKLGLIPGFGGTMRLPRVIGPDNALEWITTGKNNKALDALKVGAVDAVVEPENLTKAALNLAK 201          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
FADB_PHOPR9.064e-1143.90Fatty acid oxidation complex subunit alpha OS=Phot... [more]
FADB_IDILO9.064e-1141.98Fatty acid oxidation complex subunit alpha OS=Idio... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top