CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALCH (Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis GN=caiD PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 6.263e-20
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C E A   LPE  L I+P +GG  RLP+L+  ++  +++ TGR++S ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +            + Y   LH+ED LEG  AFAEKR P + G
Sbjct:  113 ALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALA4 (Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 6.263e-20
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C E A   LPE  L I+P +GG  RLP+L+  ++  +++ TGR++S ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +            + Y   LH+ED LEG  AFAEKR P + G
Sbjct:  113 ALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALPB (Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.179e-20
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C E A   LPE  L I+P +GG  RLP+L+  ++  +++ TGR++S ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +            + Y   LH+ED LEG  AFAEKR P + G
Sbjct:  113 ALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALG2 (Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.179e-20
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C E A   LPE  L I+P +GG  RLP+L+  ++  +++ TGR++S ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +            + Y   LH+ED LEG  AFAEKR P + G
Sbjct:  113 ALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALEP (Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.179e-20
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C E A   LPE  L I+P +GG  RLP+L+  ++  +++ TGR++S ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +            + Y   LH+ED LEG  AFAEKR P + G
Sbjct:  113 ALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALDC (Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.179e-20
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C E A   LPE  L I+P +GG  RLP+L+  ++  +++ TGR++S ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +            + Y   LH+ED LEG  AFAEKR P + G
Sbjct:  113 ALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_PROSL (Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3)

HSP 1 Score: 95.1301 bits (235), Expect = 1.395e-19
Identity = 51/148 (34.46%), Postives = 81/148 (54.73%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D+ IC + A   LPE  L I+P +GG  RLP+ +  ++  +++ TGR+++ ++A+  G+ N  V A +    A E+A +I    P+A+   K       E+ +    +L      + Y   LH+ED LEG  AFAEKR P++ G
Sbjct:  113 ALAADMIICSDNASFALPEAQLGIVPDSGGVLRLPKRLPPAIVNEMLMTGRRMNAQEALRWGIANRVVSATELMDSARELADQIANSAPLAVAALKEIYRATSELSIEEGYKLMRSGVLKYYPRVLHSEDALEGPLAFAEKRSPEWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_PROMH (Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.395e-19
Identity = 51/148 (34.46%), Postives = 81/148 (54.73%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D+ IC + A   LPE  L I+P +GG  RLP+ +  ++  +++ TGR+++ ++A+  G+ N  V A +    A E+A +I    P+A+   K       E+ +    +L      + Y   LH+ED LEG  AFAEKR P++ G
Sbjct:  113 ALAADMIICSDNASFALPEAQLGIVPDSGGVLRLPKRLPPAIVNEMLMTGRRMNAQEALRWGIANRVVSATELMDSARELADQIANSAPLAVAALKEIYRATSELSIEEGYKLMRSGVLKYYPRVLHSEDALEGPLAFAEKRSPEWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SHIFL (Carnitinyl-CoA dehydratase OS=Shigella flexneri GN=caiD PE=3 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 4.059e-19
Identity = 50/148 (33.78%), Postives = 79/148 (53.38%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEE----ECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  +C + A   LPE  L I+P +GG  RLP+++  ++  +++ TGR++  ++A+  G+VN  V   +    A E+AQ++    P+AI   K       E+ +  A         + Y   LH+ED +EG  AFAEKR P + G
Sbjct:  113 ALAADFIVCADNASFALPEAKLGIVPDSGGVLRLPKILPPTIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHSEDAIEGPLAFAEKRDPVWKG 260          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CAID_SALAR (Carnitinyl-CoA dehydratase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiD PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.059e-19
Identity = 52/152 (34.21%), Postives = 84/152 (55.26%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKR--------AITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALA D  IC + A   LPE  L I+P +GG  RLP+++  ++  D++ TGR+++ ++A+  G+VN  V   +    A E+A+++ Q  P+A+   K         ++ +G     + +L      Y   LH+ED LEG  AFAEKR P++ G
Sbjct:  113 ALAADFIICADHASFALPEAKLGIVPDSGGVLRLPKILPPAIVNDMVMTGRRMTAEEALRWGVVNRVVSPHELLDSARELARQLVQSAPLAVAALKEITRTTRDMSVEEGYRYIRSGSL----RHYPAVLHSEDALEGPLAFAEKRDPEWKG 260          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
CAID_SALCH6.263e-2035.81Carnitinyl-CoA dehydratase OS=Salmonella choleraes... [more]
CAID_SALA46.263e-2035.81Carnitinyl-CoA dehydratase OS=Salmonella agona (st... [more]
CAID_SALPB8.179e-2035.81Carnitinyl-CoA dehydratase OS=Salmonella paratyphi... [more]
CAID_SALG28.179e-2035.81Carnitinyl-CoA dehydratase OS=Salmonella gallinaru... [more]
CAID_SALEP8.179e-2035.81Carnitinyl-CoA dehydratase OS=Salmonella enteritid... [more]
CAID_SALDC8.179e-2035.81Carnitinyl-CoA dehydratase OS=Salmonella dublin (s... [more]
CAID_PROSL1.395e-1934.46Carnitinyl-CoA dehydratase OS=Proteus sp. (strain ... [more]
CAID_PROMH1.395e-1934.46Carnitinyl-CoA dehydratase OS=Proteus mirabilis (s... [more]
CAID_SHIFL4.059e-1933.78Carnitinyl-CoA dehydratase OS=Shigella flexneri GN... [more]
CAID_SALAR4.059e-1934.21Carnitinyl-CoA dehydratase OS=Salmonella arizonae ... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top