CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALTI (Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALPB (Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALNS (Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALHS (Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALG2 (Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALEP (Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALDC (Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALCH (Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALA4 (Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_YERE8 (Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=fadJ PE=3 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.035e-14
Identity = 40/71 (56.34%), Postives = 51/71 (71.83%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVP 208
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TGR+V  + A+ +GLV+  VP
Sbjct:  139 ALACHSRICSQDDKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSKALDMILTGRQVRARQALKMGLVDDVVP 209          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
FADJ_SALTI7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALPB7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALNS7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALHS7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALG27.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALEP7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALDC7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALCH7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SALA47.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_YERE81.035e-1456.34Fatty acid oxidation complex subunit alpha OS=Yers... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top