CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_VIBPA (Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.035e-14
Identity = 41/90 (45.56%), Postives = 58/90 (64.44%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKG 265
            ALACD R+C +     LGLPE  L ++PG+GGTQRLPRL+G   + D+I TG+++  K A  LG+V+ CVP        L++A++   KG
Sbjct:  120 ALACDYRVCTDFDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAKKLGVVDACVP----DTILLDVAKQFIDKG 205          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALSV (Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.035e-14
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALRAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHESR (Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGL 310
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G    +  K+++   L
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKRTAKPVKKSLVNQL 218          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHESM (Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGL 310
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G    +  K+++   L
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKRTAKPVKKSLVNQL 218          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHESA (Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGL 310
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G    +  K+++   L
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKRTAKPVKKSLVNQL 218          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHEB5 (Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAI 298
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G  A +  K+++
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKRAPKPVKKSL 214          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_KLEP3 (Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14
Identity = 46/95 (48.42%), Postives = 59/95 (62.11%), Query Frame = 2
Query:    2 ALACDLRICG--EAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC   E   LGLPE  L ++PG+GGTQRLPRL+G S A D++ TGR++  + A+  GLV+  VP    Q   L+ A E+  KG  A R
Sbjct:  120 ALACHGRICSDDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMMLTGRQLRARQALKAGLVDEVVP----QAILLQAAVELALKGRPASR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOL6 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6 GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHEPC (Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAI 298
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G  A +  K+++
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKRAPKPIKKSL 214          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHEON (Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGL 310
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G    +  K+++   L
Sbjct:  120 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKQIAKPVKKSLVNQL 220          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
FADJ_VIBPA1.035e-1445.56Fatty acid oxidation complex subunit alpha OS=Vibr... [more]
FADJ_SALSV1.035e-1448.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]
FADJ_SHESR1.351e-1440.95Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_SHESM1.351e-1440.95Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_SHESA1.351e-1440.95Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_SHEB51.351e-1442.57Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_KLEP31.351e-1448.42Fatty acid oxidation complex subunit alpha OS=Kleb... [more]
FADJ_ECOL61.351e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_SHEPC1.765e-1442.57Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_SHEON1.765e-1440.95Fatty acid oxidation complex subunit alpha OS=Shew... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top