CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHISS (Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHIFL (Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHIF8 (Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ERWCT (Fatty acid oxidation complex subunit alpha OS=Erwinia carotovora subsp. atroseptica GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 42/89 (47.19%), Postives = 56/89 (62.92%), Query Frame = 2
Query:    2 ALACDLRICG--EAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQK 262
            ALACD R+C   E  +LGLPE  L ++PG+GGTQRLPRL+G   A D+I TGR +    A+  GLV+  VP       A+EI ++  +K
Sbjct:  134 ALACDYRVCSLDEKTVLGLPEVQLGLLPGSGGTQRLPRLIGLDSALDLILTGRHLRAGQALRQGLVDEAVPHDILLDTAVEILKKGKRK 222          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOHS (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECO5E (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECO57 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.305e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHIB3 (Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.010e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKK 204          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_PECCP (Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.010e-14
Identity = 38/71 (53.52%), Postives = 48/71 (67.61%), Query Frame = 2
Query:    2 ALACDLRICG--EAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVP 208
            ALACD R+C   E  +LGLPE  L ++PG+GGTQRLPRL+G   A D+I TGR +    A+  GLV+  VP
Sbjct:  130 ALACDYRVCSLDEKTVLGLPEVQLGLLPGSGGTQRLPRLIGLDSALDLILTGRHLRANQALRQGLVDEAVP 200          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOSE (Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.010e-14
Identity = 40/85 (47.06%), Postives = 58/85 (68.24%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQE 250
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A++
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKK 204          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
FADJ_SHISS2.305e-1447.06Fatty acid oxidation complex subunit alpha OS=Shig... [more]
FADJ_SHIFL2.305e-1447.06Fatty acid oxidation complex subunit alpha OS=Shig... [more]
FADJ_SHIF82.305e-1447.06Fatty acid oxidation complex subunit alpha OS=Shig... [more]
FADJ_ERWCT2.305e-1447.19Fatty acid oxidation complex subunit alpha OS=Erwi... [more]
FADJ_ECOHS2.305e-1447.06Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECO5E2.305e-1447.06Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECO572.305e-1447.06Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_SHIB33.010e-1447.06Fatty acid oxidation complex subunit alpha OS=Shig... [more]
FADJ_PECCP3.010e-1453.52Fatty acid oxidation complex subunit alpha OS=Pect... [more]
FADJ_ECOSE3.010e-1447.06Fatty acid oxidation complex subunit alpha OS=Esch... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top