CX300438
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300438 vs. ExPASy Swiss-Prot
Match: CISD2_DROME (CDGSH iron sulfur domain-containing protein 2 homolog OS=Drosophila melanogaster GN=CG1458 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.275e-14 Identity = 33/61 (54.10%), Postives = 46/61 (75.41%), Query Frame = 2 Query: 62 NLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 244 N IRK E KVVD + V ++++ A+CRCW++ +P CDGSH +HNK TGDNVGP+++KK Sbjct: 74 NNHIRKNEPKVVDMIDVEDIAEK-AAFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK 133
BLAST of CX300438 vs. ExPASy Swiss-Prot
Match: CISD2_DROPS (CDGSH iron sulfur domain-containing protein 2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13095 PE=3 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 3.619e-13 Identity = 33/62 (53.23%), Postives = 45/62 (72.58%), Query Frame = 2 Query: 62 NLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 247 N IRK E KVV V V +++ A+CRCW++ +P CDGSH +HNK TGDNVGP+++KK+ Sbjct: 72 NSSIRKNEAKVVTMVDVEDIAGQ-AAFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPVVVKKK 132 The following BLAST results are available for this feature:
BLAST of CX300438 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300438 ID=CX300438; Name=CX300438; organism=Citrus clementina; type=EST; length=384bpback to top |